KEGG   Mus musculus (mouse): 12015Help
Entry
12015             CDS       T01002                                 

Gene name
Bad, AI325008, Bbc2
Definition
(RefSeq) BCL2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04140  Autophagy - animal
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    12015 (Bad)
   04012 ErbB signaling pathway
    12015 (Bad)
   04370 VEGF signaling pathway
    12015 (Bad)
   04024 cAMP signaling pathway
    12015 (Bad)
   04022 cGMP-PKG signaling pathway
    12015 (Bad)
   04151 PI3K-Akt signaling pathway
    12015 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    12015 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    12015 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12015 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    12015 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    12015 (Bad)
   04919 Thyroid hormone signaling pathway
    12015 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    12015 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12015 (Bad)
   05203 Viral carcinogenesis
    12015 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12015 (Bad)
   05212 Pancreatic cancer
    12015 (Bad)
   05225 Hepatocellular carcinoma
    12015 (Bad)
   05221 Acute myeloid leukemia
    12015 (Bad)
   05220 Chronic myeloid leukemia
    12015 (Bad)
   05218 Melanoma
    12015 (Bad)
   05211 Renal cell carcinoma
    12015 (Bad)
   05215 Prostate cancer
    12015 (Bad)
   05213 Endometrial cancer
    12015 (Bad)
   05223 Non-small cell lung cancer
    12015 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12015 (Bad)
   05014 Amyotrophic lateral sclerosis (ALS)
    12015 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12015 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12015 (Bad)
   05162 Measles
    12015 (Bad)
   05161 Hepatitis B
    12015 (Bad)
   05160 Hepatitis C
    12015 (Bad)
   05168 Herpes simplex virus 1 infection
    12015 (Bad)
   05165 Human papillomavirus infection
    12015 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    12015 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    12015 (Bad)
   01524 Platinum drug resistance
    12015 (Bad)
   01522 Endocrine resistance
    12015 (Bad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2_BAD Bclx_interact
Motif
Other DBs
NCBI-GeneID: 12015
NCBI-ProteinID: NP_031548
MGI: 1096330
Ensembl: ENSMUSG00000024959
Vega: OTTMUSG00000016347
UniProt: Q61337
LinkDB All DBs
Structure
PDB: 

Position
19; 19 A
AA seq 204 aa AA seqDB search
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
AGWTRIIQSWWDRNLGKGGSTPSQ
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccccaaagcagccctcgctggctcctgcacacgccctaggcttgaggaagtcc
gatcccggaatccggagcctggggagcgacgcgggaggaaggcggtggagaccagcagcc
cagagtatgttccagatcccagagtttgagccgagtgagcaggaagacgctagtgctaca
gataggggcctgggccctagcctcactgaggaccagccaggtccctacctggccccaggt
ctcctggggagcaacattcatcagcagggacgggcagccaccaacagtcatcatggaggc
gcaggggctatggagactcggagtcgccacagttcgtacccagcggggaccgaggaggat
gaagggatggaggaggagcttagcccttttcgaggacgctcgcgttcggctccccccaat
ctctgggcagcgcagcgctacggccgtgagctccgaaggatgagcgatgagtttgagggt
tccttcaagggacttcctcgcccaaagagcgcaggcactgcaacacagatgcgacaaagc
gccggctggacgcgcattatccagtcctggtgggatcgaaacttgggcaaaggaggctcc
accccctcccagtga

DBGET integrated database retrieval system