KEGG   Mus musculus (mouse): 12028Help
Entry
12028             CDS       T01002                                 

Gene name
Bax
Definition
(RefSeq) BCL2-associated X protein
  KO
K02159  apoptosis regulator BAX
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04071  Sphingolipid signaling pathway
mmu04115  p53 signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04722  Neurotrophin signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05020  Prion diseases
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12028 (Bax)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    12028 (Bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12028 (Bax)
   04215 Apoptosis - multiple species
    12028 (Bax)
   04217 Necroptosis
    12028 (Bax)
   04115 p53 signaling pathway
    12028 (Bax)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    12028 (Bax)
  09149 Aging
   04211 Longevity regulating pathway
    12028 (Bax)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12028 (Bax)
   05202 Transcriptional misregulation in cancer
    12028 (Bax)
   05203 Viral carcinogenesis
    12028 (Bax)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12028 (Bax)
   05212 Pancreatic cancer
    12028 (Bax)
   05225 Hepatocellular carcinoma
    12028 (Bax)
   05226 Gastric cancer
    12028 (Bax)
   05214 Glioma
    12028 (Bax)
   05216 Thyroid cancer
    12028 (Bax)
   05220 Chronic myeloid leukemia
    12028 (Bax)
   05217 Basal cell carcinoma
    12028 (Bax)
   05218 Melanoma
    12028 (Bax)
   05213 Endometrial cancer
    12028 (Bax)
   05224 Breast cancer
    12028 (Bax)
   05222 Small cell lung cancer
    12028 (Bax)
   05223 Non-small cell lung cancer
    12028 (Bax)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    12028 (Bax)
   05016 Huntington disease
    12028 (Bax)
   05020 Prion diseases
    12028 (Bax)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12028 (Bax)
   04933 AGE-RAGE signaling pathway in diabetic complications
    12028 (Bax)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12028 (Bax)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12028 (Bax)
   05170 Human immunodeficiency virus 1 infection
    12028 (Bax)
   05162 Measles
    12028 (Bax)
   05164 Influenza A
    12028 (Bax)
   05161 Hepatitis B
    12028 (Bax)
   05160 Hepatitis C
    12028 (Bax)
   05168 Herpes simplex virus 1 infection
    12028 (Bax)
   05163 Human cytomegalovirus infection
    12028 (Bax)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12028 (Bax)
   05169 Epstein-Barr virus infection
    12028 (Bax)
   05165 Human papillomavirus infection
    12028 (Bax)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    12028 (Bax)
   01524 Platinum drug resistance
    12028 (Bax)
   01522 Endocrine resistance
    12028 (Bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12028 (Bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    12028 (Bax)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    12028 (Bax)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   12028 (Bax)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 CF222
Motif
Other DBs
NCBI-GeneID: 12028
NCBI-ProteinID: NP_031553
MGI: 99702
Ensembl: ENSMUSG00000003873
Vega: OTTMUSG00000059409
UniProt: Q07813 Q544Z6
LinkDB All DBs
Structure
PDB: 

Position
7 B3; 7 29.32 cM
AA seq 192 aa AA seqDB search
MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLS
ECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcagcttgggagcggcgggcccaccagctctgaacagatcatg
aagacaggggcctttttgctacagggtttcatccaggatcgagcagggaggatggctggg
gagacacctgagctgaccttggagcagccgccccaggatgcgtccaccaagaagctgagc
gagtgtctccggcgaattggagatgaactggacagcaatatggagctgcagaggatgatt
gctgacgtggacacggactccccccgagaggtcttcttccgggtggcagctgacatgttt
gctgatggcaacttcaactggggccgcgtggttgccctcttctactttgctagcaaactg
gtgctcaaggccctgtgcactaaagtgcccgagctgatcagaaccatcatgggctggaca
ctggacttcctccgtgagcggctgcttgtctggatccaagaccagggtggctgggaaggc
ctcctctcctacttcgggacccccacatggcagacagtgaccatctttgtggctggagtc
ctcaccgcctcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system