KEGG   Mus musculus (mouse): 12042Help
Entry
12042             CDS       T01002                                 

Gene name
Bcl10, AI132454, BCL-10, C81403, CARMEN, CIPER, CLAP, ME10, cE10
Definition
(RefSeq) B cell leukemia/lymphoma 10
  KO
K07368  B-cell CLL/lymphoma 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    12042 (Bcl10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    12042 (Bcl10)
   04660 T cell receptor signaling pathway
    12042 (Bcl10)
   04662 B cell receptor signaling pathway
    12042 (Bcl10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12042 (Bcl10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD Mo25 Flu_B_NS1
Motif
Other DBs
NCBI-GeneID: 12042
NCBI-ProteinID: NP_033870
MGI: 1337994
Ensembl: ENSMUSG00000028191
Vega: OTTMUSG00000055197
UniProt: Q9Z0H7 B7ZWE5
LinkDB All DBs
Position
3; 3 H2
AA seq 233 aa AA seqDB search
MEAPAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPRGLDTLVESIRREKTQSFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFAAGATNNLSRCNSDESNLSEKQRASTVMYHPEGESSTAPFFSMASSLNLPVLEVG
RTENSSFSSATLPRPGDPGAPPLPPDLRLEEGGSCGNSSEMFLPLRSRALSRQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggaggctcccgcaccgtccctcacggaggaggatttgactgaagtgaagaaggacgct
ttagagaatttacgtgtttacctgtgtgagaaaatcatagctgagagacattttgatcat
ctacgtgcaaaaaaaatactaagtagagaagacacagaagaaatttcttgccgaacttca
agtagaaaacgggctgggaagttgttagactacttacaggagaaccccaggggcctggac
accctggtggaatccatccgcagggagaaaacacagagcttcctgattcagaagataacg
gatgaggtgctaaagcttcggaatataaaactggagcacctcaaaggcctgaagtgcagc
agctgtgagccctttgcagccggagccaccaacaacctctctaggtgcaattccgatgag
agcaatctctctgagaaacagagagcatccactgtcatgtaccacccggagggagagtcc
agcacggctcccttcttctctatggcgtcgtccctgaacttgccagtcctggaagttggc
aggactgaaaacagcagcttctcttcagccactcttcctcgacctggggaccctggggct
ccccctttgcccccagaccttcggttggaagaggggggaagttgtggaaactcaagtgag
atgtttctccccttacggtcacgggctctttcacgccaatga

DBGET integrated database retrieval system