KEGG   Mus musculus (mouse): 12122Help
Entry
12122             CDS       T01002                                 

Gene name
Bid, 2700049M22Rik, AI875481, AU022477
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04071  Sphingolipid signaling pathway
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04650  Natural killer cell mediated cytotoxicity
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    12122 (Bid)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12122 (Bid)
   04215 Apoptosis - multiple species
    12122 (Bid)
   04217 Necroptosis
    12122 (Bid)
   04115 p53 signaling pathway
    12122 (Bid)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    12122 (Bid)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12122 (Bid)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12122 (Bid)
   05014 Amyotrophic lateral sclerosis (ALS)
    12122 (Bid)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12122 (Bid)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12122 (Bid)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12122 (Bid)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12122 (Bid)
   05162 Measles
    12122 (Bid)
   05164 Influenza A
    12122 (Bid)
   05161 Hepatitis B
    12122 (Bid)
   05160 Hepatitis C
    12122 (Bid)
   05168 Herpes simplex virus 1 infection
    12122 (Bid)
   05163 Human cytomegalovirus infection
    12122 (Bid)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12122 (Bid)
   05169 Epstein-Barr virus infection
    12122 (Bid)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    12122 (Bid)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BID Bcl-2
Motif
Other DBs
NCBI-GeneID: 12122
NCBI-ProteinID: NP_031570
MGI: 108093
Ensembl: ENSMUSG00000004446
Vega: OTTMUSG00000024186
UniProt: P70444
LinkDB All DBs
Structure
PDB: 

Position
6 F1; 6 57.02 cM
AA seq 195 aa AA seqDB search
MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDG
SQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSE
EDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQ
NLFSYVRNLVRNEMD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggactctgaggtcagcaacggttccggcctgggggccgagcacatcacagacctgctg
gtgttcggctttctccaaagctctggctgtactcgccaagagctggaggtgctgggtcgg
gaactgcctgtgcaagcttactgggaggcagacctcgaagacgagctgcagacagatggc
agccaggccagccgctccttcaaccaaggaagaatagagccagattctgaaagtcaggaa
gaaatcatccacaacattgccagacatctcgcccaaataggcgatgagatggaccacaac
atccagcccacactggtgagacagctagccgcacagttcatgaatggcagcctgtcggag
gaagacaaaaggaactgcctggccaaagcccttgatgaggtgaagacagccttccccaga
gacatggagaacgacaaggccatgctgataatgaccatgctgttggccaaaaaagtggcc
agtcacgcaccatctttgctccgtgatgtcttccacacgactgtcaactttattaaccag
aacctattctcctatgtgaggaacttggttagaaacgagatggactga

DBGET integrated database retrieval system