KEGG   Mus musculus (mouse): 12125Help
Entry
12125             CDS       T01002                                 

Gene name
Bcl2l11, 1500006F24Rik, Bim, Bod, bcl2-L-11
Definition
(RefSeq) BCL2-like 11 (apoptosis facilitator)
  KO
K16341  Bcl-2-like protein 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12125 (Bcl2l11)
   04151 PI3K-Akt signaling pathway
    12125 (Bcl2l11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12125 (Bcl2l11)
   04215 Apoptosis - multiple species
    12125 (Bcl2l11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12125 (Bcl2l11)
   05206 MicroRNAs in cancer
    12125 (Bcl2l11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12125 (Bcl2l11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12125 (Bcl2l11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    12125 (Bcl2l11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    12125 (Bcl2l11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bim_N Bclx_interact BMF PXT1
Motif
Other DBs
NCBI-GeneID: 12125
NCBI-ProteinID: NP_997563
MGI: 1197519
Ensembl: ENSMUSG00000027381
Vega: OTTMUSG00000015356
UniProt: O54918 Q542N5
LinkDB All DBs
Structure
PDB: 

Position
2; 2 F1
AA seq 196 aa AA seqDB search
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPL
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMV
ILQLLRFIFRLVWRRH
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcaaccttctgatgtaagttctgagtgtgacagagaaggtggacaattgcag
cctgctgagaggcctccccagctcaggcctggggcccctacctccctacagacagaaccg
caaggtaatcccgacggcgaaggggaccgctgcccccacggcagccctcagggcccgctg
gccccaccggccagccctggcccttttgctaccagatccccacttttcatctttgtgaga
agatcttctctgctgtcccggtcctccagtgggtatttctcttttgacacagacaggagc
ccggcacccatgagttgtgacaagtcaacacaaaccccaagtcctccttgccaggccttc
aaccactatctcagtgcaatggcttccatacgacagtctcaggaggaacctgaagatctg
cgcccggagatacggattgcacaggagctgcggcggatcggagacgagttcaacgaaact
tacacaaggagggtgtttgcaaatgattaccgcgaggctgaagaccaccctcaaatggtt
atcttacaactgttacgctttatcttccgtctggtatggagaaggcattga

DBGET integrated database retrieval system