KEGG   Mus musculus (mouse): 12151Help
Entry
12151             CDS       T01002                                 

Gene name
Bmi1, AW546694, Bmi-1, Pcgf4
Definition
(RefSeq) Bmi1 polycomb ring finger oncogene
  KO
K11459  polycomb group RING finger protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12151 (Bmi1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12151 (Bmi1)
   05206 MicroRNAs in cancer
    12151 (Bmi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12151 (Bmi1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     12151 (Bmi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-RING_10 zf-Nse
Motif
Other DBs
NCBI-GeneID: 12151
NCBI-ProteinID: NP_031578
MGI: 88174
Ensembl: ENSMUSG00000026739
Vega: OTTMUSG00000011429
UniProt: P25916 Q2LC58
LinkDB All DBs
Structure
PDB: 

Position
2 A3; 2 12.9 cM
AA seq 324 aa AA seqDB search
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
EKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSK
MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDG
LTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSA
NHQSSFASRPRKSSLNGSSATSSG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgaacaaccagaatcaagatcactgagctaaatccccacttaatgtgtgtcctg
tgtggagggtacttcattgatgccactaccataatagaatgtctacattccttctgtaaa
acatgtattgtacgttacttggagaccagcaagtattgtcctatttgtgatgtccaggtt
cacaaaaccagaccactcctgaacataaggtcagataaaactcttcaagatattgtatac
aaattagtcccagggcttttcaaaaatgagatgaagagaagaagagatttttatgcagct
cacccgtcagctgatgctgccaatggctccaatgaagaccgaggagaagttgcagatgag
gagaagaggattataactgatgatgagataataagcttgtctattgagttctttgatcag
agcagattggatcggaaagtaaataaagagaagcctaaggaagaggtgaatgataaaagg
tacttacgatgcccagcagcaatgactgtgatgcacttgagaaagtttctcaggagtaaa
atggacatacccaatactttccagattgacgtcatgtatgaagaggaacctttaaaggat
tactacacgctaatggacattgcctacatttatacctggagaagaaatggcccactacct
ttgaaatacagagttcggccaacttgcaaaagaatgaagatgagtcaccagagggatgga
ctgacgaatgctggagagctggaaagtgactctgggagtgacaaggccaacagcccagcc
ggaggtgttccctccacctcttcctgtttgcccagtcccagcactccagtgcagtctcct
cacccacagttccctcacatttccagtaccatgaatggaaccagcaacagccccagtgct
aaccaccaatcttcctttgccagtagacctcgaaaatcatcactaaatgggtcatcagca
acttcatctggttag

KEGG   Mus musculus (mouse): 22658Help
Entry
22658             CDS       T01002                                 

Gene name
Pcgf2, Mel18, Rnf110, Zfp144, mel-18
Definition
(RefSeq) polycomb group ring finger 2
  KO
K11460  polycomb group RING finger protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    22658 (Pcgf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    22658 (Pcgf2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     22658 (Pcgf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX zf-C3HC4_4 Prok-RING_4 Rad60-SLD zf-Nse zf-ANAPC11 zf-RING_10 FAP
Motif
Other DBs
NCBI-GeneID: 22658
NCBI-ProteinID: NP_001156779
MGI: 99161
Ensembl: ENSMUSG00000018537
Vega: OTTMUSG00000002751
UniProt: P23798
LinkDB All DBs
Position
11 D; 11 61.06 cM
AA seq 342 aa AA seqDB search
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALGDDEIVSLSIEFYEGVRDREEKKNLTENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEILYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLPT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggaccacacggattaaaatcacggagctgaaccctcacctcatgtgtgccctc
tgtgggggctattttattgatgccaccaccattgtggaatgcttacattccttctgcaaa
acctgcatcgtacgctacttggagaccaacaaatactgccccatgtgtgacgtccaggtc
cataaaactcgaccactgctgagcatcagatcagacaaaaccctccaggacattgtctac
aagttggtgcctgggctttttaaagatgaaatgaaacggcgacgggacttctatgcagca
taccccctgacagaggtccccaacggctccaacgaggaccgaggcgaggtcctggaacag
gagaagggggctctgggtgacgacgagattgtcagtctttccattgagttctacgaaggc
gtcagggaccgagaggagaagaagaacctcacggagaatggagatggggacaaggagaag
acaggagtgcgattcctgcggtgcccagcagccatgaccgtcatgcacctggcaaagttc
ctccgcaacaaaatggatgtgcccagcaagtacaaggtggagatcctctatgaagatgag
cccctgaaggaatactacaccttaatggacattgcgtacatctacccctggcgaaggaat
gggcctctccccctcaagtaccgtgtccagccagcctgcaagcggctcaccctgcccacg
gtgccaaccccctcagaaggcaccaacaccagcggggcatcagagtgtgagtcagtcagc
gacaaggctcccagccctgccacccttccggccacctcctcctccttgcccagccctgcg
accccatcccatggctctcccagctcccacggccccccagctacccatcctacttccccc
actccaccttcaactgccgctgggaccaccacagctaccaatgggggcacttcgaactgc
ctgcaaacgccatcctccaccagcagggggcgcaagatgactgttaatggcgctccttgc
cccccttga

KEGG   Mus musculus (mouse): 69587Help
Entry
69587             CDS       T01002                                 

Gene name
Pcgf3, 2310035N15Rik, AI662857, D630042K08Rik, DONG1, E430039C14, RNF3A, Rnf3
Definition
(RefSeq) polycomb group ring finger 3
  KO
K11488  polycomb group RING finger protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    69587 (Pcgf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    69587 (Pcgf3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     69587 (Pcgf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-RING_UBOX zf-rbx1 zf-C3HC4_4 zf-RING_4 zf-Nse DUF3337 GAGA Prok-RING_4 zf-RING_10
Motif
Other DBs
NCBI-GeneID: 69587
NCBI-ProteinID: NP_766304
MGI: 1916837
Ensembl: ENSMUSG00000033623
Vega: OTTMUSG00000017424
UniProt: Q8BTQ0
LinkDB All DBs
Position
5; 5 F
AA seq 241 aa AA seqDB search
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIH
QSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLD
PRNGETKADDNSNKETAEEKQEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQAT
VLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDL
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccaggaagattaaactctgggatataaatgcccacatcacctgccgcctgtgc
agcggctacctcattgacgcaaccacagtgactgagtgtttgcacacattctgcaggagc
tgcctggtgaagtatctggaggagaataatacctgccccacctgcaggatcgtgatccat
cagagccacccattacagtatatcggtcatgacagaaccatgcaggacattgtttacaag
ctggtgccaggcctccaggaagcggaaatgaggaaacagagggaattctatcacaaactg
ggcatggaggtaccaggtgacatcaagggggaggcgtgctcagcaaaacagcacttagat
ccccgaaatggtgaaaccaaagcagacgacaattcaaataaagagacagcagaggagaag
caggaggaggacaatgactaccacaggagtgacgagcaggtaagcatctgtctggaatgc
aacagcagcaaactacgtggcctcaagcggaagtggatcagatgctcagcccaagcaact
gtgctgcacctgaaaaaatttatcgccaagaagcttaacctctcctcctttaatgagctg
gacattttatgcaatgaggagatcctgggcaaggaccacactctcaagttcgtggttgtt
acaagatggagattcaagaaggcacccctcctgctacactacagacccaagatggacttg
ctgtaa

KEGG   Mus musculus (mouse): 69837Help
Entry
69837             CDS       T01002                                 

Gene name
Pcgf1, 2010002K04Rik, AU024121, Nspc1
Definition
(RefSeq) polycomb group ring finger 1
  KO
K11487  polycomb group RING finger protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    69837 (Pcgf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    69837 (Pcgf1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     69837 (Pcgf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_UBOX zf-RING_5 Rad60-SLD zf-Nse Atg8 zf-ANAPC11 zf-C3HC4_4 Prok-RING_4 ubiquitin
Motif
Other DBs
NCBI-GeneID: 69837
NCBI-ProteinID: NP_932109
MGI: 1917087
Ensembl: ENSMUSG00000069678
Vega: OTTMUSG00000039809
UniProt: Q8R023 A0A0R4J141
LinkDB All DBs
Position
6 C3; 6 35.94 cM
AA seq 247 aa AA seqDB search
MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCI
VKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGL
DRVSQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYV
RCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQY
SVKEKRR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcggaaccagctccagtcagtgtacaagatggacccactacggaacgaggag
gaggtccgggtgaagatcaaagacctgaatgaacacatcgtttgctgcctgtgcgcgggc
tacttcgtggatgccaccaccatcacagagtgtctccacaccttctgcaaaagttgtatc
gtgaagtacctgcaaaccagcaagtactgccccatgtgcaacatcaagatccacgagacg
cagccgttgctcaatctcaaactggatcgggtcatgcaggacatagtgtataagctagtg
ccaggcttgcaagacagtgaagagaaacggattcgggaattctatcagtcccgaggctta
gacagagtctcccagcccagtggtgaagagccagccctgagcaaccttggcctccccttc
agcagttttgaccactctaaagcccactattatcgatatgatgaacagctgagcctatgc
ctggagcggctgagttctggcaaagacaagaataaaaatgtccttcagaacaagtatgtt
cggtgttctgtgagagctgaggtccgccatctccgaagggttctgtgtcaccgactaatg
ctaaatccacagcatgtacagctcctttttgacaatgaggttctcccagatcacatgaca
atgaaacagctatggctgtcccgctggttcggcaagccatctcctttgcttctccaatac
agtgtgaaagagaagaggaggtag

KEGG   Mus musculus (mouse): 71041Help
Entry
71041             CDS       T01002                                 

Gene name
Pcgf6, 4933407A11Rik, AI604840, MBLR, Rnf134
Definition
(RefSeq) polycomb group ring finger 6
  KO
K11470  polycomb group RING finger protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    71041 (Pcgf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    71041 (Pcgf6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     71041 (Pcgf6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf-C3HC4 RAWUL zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 PBP1_TM zf-RING_6 zf-RING_10 zf-C3HC4_4 Prok-RING_4 zf-rbx1 zf-C3HC4_5 Mito_fiss_reg
Motif
Other DBs
NCBI-GeneID: 71041
NCBI-ProteinID: NP_081930
MGI: 1918291
Ensembl: ENSMUSG00000025050
UniProt: Q99NA9
LinkDB All DBs
Position
19; 19 C3
AA seq 353 aa AA seqDB search
MDEAETDATENKRASEAKRASAMPPPPPPPPPISPPALIPAPAAGEEGPASLGQAGAAGC
SRSRPPALEPERSLGRLRGRFEDYDEELEEEEEMEEEEEEEEEMSHFSLRLESGRADSED
EEERLINLVELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVH
QTQPLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAAPQPVPSSKGKT
KKVLESVFRIPPELDMSLLLEFIGANEDTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMG
LDPACQVDIICGDHLLERYQTLREIRRAIGDTAMQDGLLVLHYGLVVSPLKIT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggctgagacggacgccacggaaaacaagcgcgcctctgaggccaagcgagcc
tcagccatgccgccaccgccaccgcctccgcctcccatctctccgcccgccctcatcccg
gcacccgcggccggcgaggagggcccggcgtccctgggccaggcgggcgctgccggctgc
tctcgctctcggcccccggcgttggagcccgagcgcagcctgggccgcttgagaggccgc
ttcgaggactacgatgaagagttggaagaggaggaggagatggaggaggaagaagaggag
gaggaagagatgagccacttctctctgcgtctggagtccggacgggcagactccgaggac
gaggaggagcgcctgataaaccttgtcgagctgaccccctacatcctgtgttcgatttgc
aaaggttacctgatagatgcaaccaccattacagagtgtcttcataccttttgtaaaagc
tgcattgtgagacatttttactatagtaacagatgcccaaaatgcaacatagttgtccac
cagactcagcctctttataatataaggttggaccggcagttacaagacatagtatacaaa
ttagtgatcaatctagaggaaagagaaaaaaagcaaatgcatgacttctataaagaaaga
ggtctagaagtccccaagcctgctgctccacagccagtcccttcaagcaaaggaaaaacc
aagaaggtcctagagtcagtgtttcgtattccacctgaacttgatatgtctttattactt
gagttcattggtgctaatgaagacaccggacattttaagccattggaaaagaagtttgtg
cgtgtttcaggagaagcaactatcgggcatgtagaaaaatttcttagaagaaaaatgggt
cttgatccagcttgtcaggtagatatcatctgtggggatcacttactggagcggtaccaa
actctacgggaaatccgacgtgcaataggtgatacagcaatgcaggacggtctgcttgtt
cttcattatggtcttgtggtttctcctttgaaaataacttga

KEGG   Mus musculus (mouse): 76073Help
Entry
76073             CDS       T01002                                 

Gene name
Pcgf5, 0610009F02Rik, 1110054A01Rik, 5830406C17Rik, 5830443C21Rik, 9530023M17Rik, AI324127
Definition
(RefSeq) polycomb group ring finger 5
  KO
K11489  polycomb group RING finger protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    76073 (Pcgf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76073 (Pcgf5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     76073 (Pcgf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-RING_10 zf-Nse Prok-RING_4 zf-RING_6 zf-rbx1 Cript DUF1272 zf-C3HC4_5
Motif
Other DBs
NCBI-GeneID: 76073
NCBI-ProteinID: NP_083784
MGI: 1923505
Ensembl: ENSMUSG00000024805
UniProt: Q3UK78
LinkDB All DBs
Position
19; 19 C2
AA seq 236 aa AA seqDB search
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQV
HETNPLEMLRLDNTLEEIIFKLVPGLREQELQRELEFWKKNKPQENGQDDISKVDKSKAD
EEGDENQDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFL
SLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENSYPMVLQYRPRIDFG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaaaggaaacacttggtgaaagacttcaacccttacatcacctgctacatc
tgtaaaggctatctgatcaagcccacgacagtgacggaatgcctccatacattctgtaag
acctgtattgtccagcactttgaagacagcaatgattgtccaaggtgtggcaaccaagtt
catgaaacaaatccattagaaatgttaaggctggataacacgttggaggaaattatcttt
aaattagtgcctggactacgagaacaagaacttcagcgtgagttggaattttggaagaaa
aacaaacctcaagaaaatgggcaagatgatatttcgaaggttgacaagtctaaagcagat
gaggaaggtgatgaaaaccaagatgataaggactatcatagaagtgacccgcaaattgct
atctgtctggactgtttacgaaataatgggcagtcaggggacaacgtagtgaagggtctc
atgaagaaatttattcgctgttctacacgagttactgtaggaactattaaaaagtttcta
agtttaaaactaaaacttccaagttcttatgagttggatgtgctgtgcaatggtgaaatt
atgggaaaggatcatactatggaattcatctatatgacaagatggcgactaagaggagaa
aattcatacccgatggtattgcagtatcgaccgagaattgattttgggtag

DBGET integrated database retrieval system