KEGG   Mus musculus (mouse): 12156Help
Entry
12156             CDS       T01002                                 

Gene name
Bmp2, AI467020, Bmp2a
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12156 (Bmp2)
   04390 Hippo signaling pathway
    12156 (Bmp2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12156 (Bmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12156 (Bmp2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    12156 (Bmp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12156 (Bmp2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12156 (Bmp2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   12156 (Bmp2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Morphogens
   12156 (Bmp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 12156
NCBI-ProteinID: NP_031579
MGI: 88177
Ensembl: ENSMUSG00000027358
Vega: OTTMUSG00000015653
UniProt: P21274
LinkDB All DBs
Position
2 F2; 2 65.21 cM
AA seq 394 aa AA seqDB search
MVAGTRCLLVLLLPQVLLGGAAGLIPELGRKKFAAASSRPLSRPSEDVLSEFELRLLSMF
GLKQRPTPSKDVVVPPYMLDLYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEEAVEEL
PEMSGKTARRFFFNLSSVPSDEFLTSAELQIFREQIQEALGNSSFQHRINIYEIIKPAAA
NLKFPVTRLLDTRLVNQNTSQWESFDVTPAVMRWTTQGHTNHGFVVEVAHLEENPGVSKR
HVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLY
VDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCV
PTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagtgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcattccagagctgggccgcaagaagttcgccgcggcatccagccgaccc
ttgtcccggccttcggaagacgtcctcagcgaatttgagttgaggctgctcagcatgttt
ggcctgaagcagagacccacccccagcaaggacgtcgtggtgcccccctatatgctagat
ctgtaccgcaggcactcaggccagccaggagcgcccgccccagaccaccggctggagagg
gcagccagccgcgccaacaccgtgcgcagcttccatcacgaagaagccgtggaggaactt
ccagagatgagtgggaaaacggcccggcgcttcttcttcaatttaagttctgtccccagt
gacgagtttctcacatctgcagaactccagatcttccgggaacagatacaggaagctttg
ggaaacagtagtttccagcaccgaattaatatttatgaaattataaagcctgcagcagcc
aacttgaaatttcctgtgaccagactattggacaccaggttagtgaatcagaacacaagt
cagtgggagagcttcgacgtcaccccagctgtgatgcggtggaccacacagggacacacc
aaccatgggtttgtggtggaagtggcccatttagaggagaacccaggtgtctccaagaga
catgtgaggattagcaggtctttgcaccaagatgaacacagctggtcacagataaggcca
ttgctagtgacttttggacatgatggaaaaggacatccgctccacaaacgagaaaagcgt
caagccaaacacaaacagcggaagcgcctcaagtccagctgcaagagacaccctttgtat
gtggacttcagtgatgtggggtggaatgactggatcgtggcacctccgggctatcatgcc
ttttactgccatggggagtgtccttttccccttgctgaccacctgaactccactaaccat
gccatagtgcagactctggtgaactctgtgaattccaaaatccctaaggcatgctgtgtc
cccacagagctcagcgcaatctccatgttgtacctagatgaaaatgaaaaggttgtgcta
aaaaattatcaggacatggttgtggagggctgcgggtgtcgttag

KEGG   Mus musculus (mouse): 12159Help
Entry
12159             CDS       T01002                                 

Gene name
Bmp4, Bmp-4, Bmp2b, Bmp2b-1, Bmp2b1
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04919  Thyroid hormone signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12159 (Bmp4)
   04390 Hippo signaling pathway
    12159 (Bmp4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12159 (Bmp4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12159 (Bmp4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    12159 (Bmp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12159 (Bmp4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    12159 (Bmp4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12159 (Bmp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12159 (Bmp4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12159 (Bmp4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   12159 (Bmp4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Morphogens
   12159 (Bmp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 12159
NCBI-ProteinID: NP_001303289
MGI: 88180
Ensembl: ENSMUSG00000021835
Vega: OTTMUSG00000019526
UniProt: P21275 Q3ULR1
LinkDB All DBs
Position
14 C1; 14 23.95 cM
AA seq 408 aa AA seqDB search
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRS
FHHEEHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQR
SRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagaccgggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctacagatgtttgggctgcgccgccgtccgcagcctagcaagagcgccgtcattccg
gattacatgagggatctttaccggctccagtctggggaggaggaggaggaagagcagagc
cagggaaccgggcttgagtacccggagcgtcccgccagccgagccaacactgtgaggagt
ttccatcacgaagaacatctggagaacatcccagggaccagtgagagctctgcttttcgt
ttcctcttcaacctcagcagcatcccagagaatgaggtgatctcctcggcagagctccgg
ctctttcgggagcaggtggaccagggccctgactgggaacagggcttccaccgtataaac
atttatgaggttatgaagcccccagcagaaatggttcctggacacctcatcacacgacta
ctggacaccagactagtccatcacaatgtgacacggtgggaaactttcgatgtgagccct
gcagtccttcgctggacccgggaaaagcaacccaattatgggctggccattgaggtgact
cacctccaccagacacggacccaccagggccagcacgtcagaatcagccgatcgttacct
caagggagtggagattgggcccaactccggcccctcctggtcacttttggccatgatggc
cggggccataccttgacccgcagaagggccaaacgtagtcccaagcatcacccacagcgg
tccaggaagaagaataagaactgccgtcgccattcactatacgtggacttcagtgacgtg
ggctggaatgattggattgtggccccacccggctaccaggccttctactgccacggggac
tgtccctttccactggctgatcacctcaactcaaccaaccatgccattgtgcagacccta
gtcaactctgttaattctagtatccctaaggcctgttgtgtccccactgaactgagtgcc
atttccatgttgtacctggatgagtatgacaaggtggtgttgaaaaattatcaggagatg
gtggtagaggggtgtggatgccgctga

DBGET integrated database retrieval system