KEGG   Mus musculus (mouse): 12190Help
Entry
12190             CDS       T01002                                 

Gene name
Brca2, Fancd1, RAB163
Definition
(RefSeq) breast cancer 2, early onset
  KO
K08775  breast cancer 2 susceptibility protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
mmu05200  Pathways in cancer
mmu05212  Pancreatic cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    12190 (Brca2)
   03460 Fanconi anemia pathway
    12190 (Brca2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12190 (Brca2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    12190 (Brca2)
   05224 Breast cancer
    12190 (Brca2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12190 (Brca2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12190 (Brca2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12190 (Brca2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    12190 (Brca2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     12190 (Brca2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     12190 (Brca2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     12190 (Brca2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Motif
Other DBs
NCBI-GeneID: 12190
NCBI-ProteinID: NP_001074470
MGI: 109337
Ensembl: ENSMUSG00000041147
Vega: OTTMUSG00000055512
UniProt: P97929
LinkDB All DBs
Structure
PDB: 

Position
5 G3; 5 89.52 cM
AA seq 3329 aa AA seqDB search
MPVEYKRRPTFWEIFKARCSTADLGPISLNWFEELSSEAPPYNSEPPEESEYKPHGYEPQ
LFKTPQRNPPYHQFASTPIMFKERSQTLPLDQSPFRELGKVVASSKHKTHSKKKTKVDPV
VDVASPPLKSCLSESPLTLRCTQAVLQREKPVVSGSLFYTPKLKEGQTPKPISESLGVEV
DPDMSWTSSLATPPTLSSTVLIARDEEARSSVTPADSPATLKSCFSNHNESPQKNDRSVP
SVIDSENKNQQEAFSQGLGKMLGDSSGKRNSFKDCLRKPIPNILEDGETAVDTSEEDSFS
LCFPKRRTRNLQKMRMGKTRKKIFSETRTDELSEEARRQTDDKNSFVFEMELRESDPLDP
GVTSQKPFYSQNEEICNEAVQCSDSRWSQSNLSGLNETQTGKITLPHISSHSQNISEDFI
DMKKEGTGSITSEKSLPHISSLPEPEKMFSEETVVDKEHEGQHFESLEDSIAGKQMVSRT
SQAACLSPSIRKSIFKMREPLDETLGTVFSDSMTNSTFTEEHEASACGLGILTACSQRED
SICPSSVDTGSWPTTLTDTSATVKNAGLISTLKNKKRKFIYSVSDDASLQGKKLQTHRQL
ELTNLSAQLEASAFEVPLTFTNVNSGIPDSSDKKRCLPNDPEEPSLTNSFGTATSKEISY
IHALISQDLNDKEAIVIEEKPQPYTAREADFLLCLPERTCENDQKSPKVSNGKEKVLVSA
CLPSAVQLSSISFESQENPLGDHNGTSTLKLTPSSKLPLSKADMVSREKMCKMPEKLQCE
SCKVNIELSKNILEVNEICILSENSKTPGLLPPGENIIEVASSMKSQFNQNAKIVIQKDQ
KGSPFISEVAVNMNSEELFPDSGNNFAFQVTNKCNKPDLGSSVELQEEDLSHTQGPSLKN
SPMAVDEDVDDAHAAQVLITKDSDSLAVVHDYTEKSRNNIEQHQKGTEDKDFKSNSSLNM
KSDGNSDCSDKWSEFLDPVLNHNFGGSFRTASNKEIKLSEHNVKKSKMFFKDIEEQYPTR
LACIDIVNTLPLANQKKLSEPHIFDLKSVTTVSTQSHNQSSVSHEDTDTAPQMLSSKQDF
HSNNLTTSQKAEITELSTILEESGSQFEFTQFRKPSHIAQNTSEVPGNQMVVLSTASKEW
KDTDLHLPVDPSVGQTDHSKQFEGSAGVKQSFPHLLEDTCNKNTSCFLPNINEMEFGGFC
SALGTKLSVSNEALRKAMKLFSDIENSEEPSAKVGPRGFSSSAHHDSVASVFKIKKQNTE
KSFDEKSSKCQVTLQNNIEMTTCIFVGRNPEKYIKNTKHEDSYTSSQRNNLENSDGSMSS
TSGPVYIHKGDSDLPADQGSKCPESCTQYAREENTQIKENISDLTCLEIMKAEETCMKSS
DKKQLPSDKMEQNIKEFNISFQTASGKNTRVSKESLNKSVNIFNRETDELTVISDSLNSK
ILHGINKDKMHTSCHKKAISIKKVFEDHFPIVTVSQLPAQQHPEYEIESTKEPTLLSFHT
ASGKKVKIMQESLDKVKNLFDETQYVRKTASFSQGSKPLKDSKKELTLAYEKIEVTASKC
EEMQNFVSKETEMLPQQNYHMYRQTENLKTSNGTSSKVQENIENNVEKNPRICCICQSSY
PVTEDSALAYYTEDSRKTCVRESSLSKGRKWLREQGDKLGTRNTIKIECVKEHTEDFAGN
ASYEHSLVIIRTEIDTNHVSENQVSTLLSDPNVCHSYLSQSSFCHCDDMHNDSGYFLKNK
IDSDVPPDMKNAEGNTISPRVSATKERNLHPQTINEYCVQKLETNTSPHANKDVAIDPSL
LDSRNCKVGSLVFITAHSQETERTKEIVTDNCYKIVEQNRQSKPDTCQTSCHKVLDDSKD
FICPSSSGDVCINSRKDSFCPHNEQILQHNQSMSGLKKAATPPVGLETWDTSKSIREPPQ
AAHPSRTYGIFSTASGKAIQVSDASLEKARQVFSEMDGDAKQLSSMVSLEGNEKPHHSVK
RENSVVHSTQGVLSLPKPLPGNVNSSVFSGFSTAGGKLVTVSESALHKVKGMLEEFDLIR
TEHTLQHSPIPEDVSKILPQPCAEIRTPEYPVNSKLQKTYNDKSSLPSNYKESGSSGNTQ
SIEVSLQLSQMERNQDTQLVLGTKVSHSKANLLGKEQTLPQNIKVKTDEMKTFSDVPVKT
NVGEYYSKESENYFETEAVESAKAFMEDDELTDSEQTHAKCSLFTCPQNETLFNSRTRKR
GGVTVDAVGQPPIKRSLLNEFDRIIESKGKSLTPSKSTPDGTVKDRSLFTHHMSLEPVTC
GPFCSSKERQGAQRPHLTSPAQELLSKGHPWRHSALEKSPSSPIVSILPAHDVSATRTER
TRHSGKSTKVFVPPFKMKSQFHGDEHFNSKNVNLEGKNQKSTDGDREDGNDSHVRQFNKD
LMSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPKQ
LYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEE
FYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYR
YDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTI
ELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPDACAPLEAPDSLRLKIS
ANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPLQWVEKTVSGLY
IFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHEEDTTQRCVLSRTLTRQQVHALQ
DGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEE
GLSRDVTTVWKLRVTSYKKKEKSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSKSKFE
RPSIQLTATKRTQYQQLPVSSETLLQVYQPRESLHFSRLSDPAFQPPCSEVDVVGVVVSV
VKPIGLAPLVYLSDECLNLLVVKFGIDLNEDIKPRVLIAASNLQCQPESTSGVPTLFAGH
FSIFSASPKEAYFQEKVNNLKHAIENIDTFYKEAEKKLIHVLEGDSPKWSTPNKDPTREP
HAASTCCASDLLGSGGQFLRISPTGQQSYQSPLSHCTLKGKSMPLAHSAQMAAKSWSGEN
EIDDPKTCRKRRALDFLSRLPLPSPVSPICTFVSPAAQKAFQPPRSCGTKYATPIKKEPS
SPRRRTPFQKTSGVSLPDCDSVADEELALLSTQALTPDSVGGNEQAFPGDSTRNPQPAQR
PDQQVGPRSRKESLRDCRGDSSEKLAVES
NT seq 9990 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgaatacaaaaggagaccaactttttgggaaatttttaaggcgagatgcagc
acagcagatttaggaccgataagcctcaattggtttgaggagctttcctcagaagccccc
ccatacaattctgaacctccggaggaatctgagtataagccccacggttatgaaccacag
ctgtttaaaacaccacagaggaatcccccctaccatcagtttgcttcaactccaataatg
ttcaaagaacgaagtcaaactctaccactggaccagtcgcctttcagagaattagggaag
gttgttgcaagtagtaaacataaaactcacagcaaaaagaagaccaaagtggaccctgtg
gtagatgttgctagtccgcctctgaaatcttgtctcagtgaaagccctcttactctgcgg
tgcacacaggcagtactacaacgagaaaagccagtggtatctggaagtttattttataca
ccaaaactcaaggagggtcagacaccaaaacctatttctgagagtctgggagttgaagtg
gatcctgatatgtcttggacaagctcattagctacaccaccaacccttagttccactgtg
ctcatagcccgagatgaagaagcacgcagctctgtaacgcctgctgactctcccgctact
ttgaaaagctgtttttctaaccacaatgaaagtccacaaaaaaatgatagatctgttccc
tcagtgattgacagtgaaaacaaaaaccagcaagaagcttttagtcagggtttggggaaa
atgttaggagattcatctggcaaaagaaatagcttcaaagactgccttagaaagccaata
ccaaatattctagaagatggggagacagctgttgatacttccgaagaagatagtttctca
ttatgttttcctaagcgtagaaccagaaatctacagaaaatgagaatgggcaagacaagg
aaaaaaattttcagtgaaacaagaactgatgaattaagcgaagaagctagaagacaaact
gatgataaaaactcatttgtatttgaaatggaactaagagagagtgatcctttagatcca
ggtgtaacaagccagaagcccttttacagccagaatgaggaaatctgcaatgaagctgta
cagtgttcagatagtagatggtctcagtcaaacctttctggtctaaatgaaacccagaca
ggaaaaataaccttacctcatatttcttctcatagccaaaatatttcagaagacttcata
gatatgaagaaagaaggtactggctctattacttcagaaaaatctttacctcatatttct
agtcttccagaaccggaaaagatgttcagtgaggagactgtggtagataaggaacatgaa
ggacagcattttgaatcacttgaagactccattgcagggaagcaaatggtgtctagaaca
agtcaagcagcctgtctttctccgagtatcaggaagtctatattcaagatgagagagcca
cttgacgagactttgggtactgttttctcagatagtatgaccaactcaacctttacagaa
gaacatgaagcctctgcatgtggattgggaatacttactgcatgctcacagagagaggat
tctatatgtcctagttcagttgacactggaagctggccaaccactctcactgacacttct
gccactgtgaaaaatgcaggtttgatatccactctaaaaaataaaaaaagaaagtttatt
tactctgtaagtgatgatgcatctcttcaaggaaaaaaactacagacacacagacagtta
gagcttactaatctttcagcccagcttgaagcaagtgcttttgaagtaccattgaccttt
acaaatgtaaattcaggtataccagattcttctgacaaaaaacgctgtttaccgaatgat
cctgaagagccatccttgaccaactcttttgggactgctaccagtaaagaaattagttat
attcatgcattgatatctcaggatcttaatgacaaagaagcaatagtcattgaagaaaaa
ccacagccatatacagcccgagaagctgactttctgttatgcttgccagaaagaacatgt
gaaaatgaccaaaaaagtccaaaagtttccaatggaaaagaaaaagtcttagtttcagca
tgtcttccttcagcagtgcaactcagcagcattagctttgaatcacaggaaaaccctctt
ggtgaccacaacggaacaagtactcttaaattaactcccagctcaaagctacctctgtca
aaggcagacatggtttctagagagaaaatgtgtaaaatgccagagaaactgcaatgtgag
agttgtaaagttaatattgaactaagtaaaaacatcttggaggtaaatgaaatatgtatc
ttaagtgaaaattctaaaactcctgggcttctgccacctggtgaaaatataatagaagtg
gcctcttcaatgaagtcacagttcaatcaaaatgcaaaaatagtcatacagaaggaccaa
aaaggctcaccttttatttcagaagtagcagtcaatatgaactctgaagaacttttccca
gacagtgggaataattttgcttttcaagtaactaataaatgcaataagcctgatttagga
agttcagtggaactccaggaagaagacctcagccacacacaagggcctagtctcaagaac
tctcccatggcagtagatgaagatgtagatgatgcgcatgcagcccaagtgttgattaca
aaggactcagattcattagctgtggtccatgattatacagagaagagcagaaataatata
gagcagcaccagaaaggaaccgaagacaaagatttcaagtcaaattcctccttgaatatg
aaatcagatgggaacagtgattgttcagacaaatggtcagagttcttggatccagtcttg
aaccataattttggaggtagcttcagaacagcttccaataaagaaataaaactttcagag
cataatgtcaagaaaagtaaaatgttcttcaaagatattgaagaacagtatcctactagg
ttagcttgtattgacattgttaatacccttccattagcaaaccagaagaaactaagtgaa
cctcatatatttgatttgaaatcagttactactgtatctacacagtctcacaatcaatca
tctgtttctcatgaagatactgacacagcacctcagatgttatcttcaaagcaagatttt
cattcaaataatttaacgaccagccaaaaagcagaaattacagaactgtctactattttg
gaagaatcaggaagtcagtttgaattcacacagttcagaaagccaagccacatagcacag
aatacatctgaagtgcctggaaaccagatggttgttttaagtaccgcttctaaggagtgg
aaagatactgatcttcacctcccagtggatccctctgtaggtcagacagatcacagcaag
caatttgaaggttcggctggagttaaacaaagctttcctcacctgttagaagacacttgt
aacaaaaatacatcttgttttttaccaaatataaatgaaatggagtttggaggattttgt
tctgctcttggcacaaaacttagtgtgtctaatgaggctctgagaaaagctatgaaactg
ttcagtgacattgaaaatagtgaggagccttctgcaaaagtaggaccaagaggattctct
tcaagtgcacaccatgattctgttgcttcagtgtttaagataaagaaacaaaacactgaa
aaaagttttgatgaaaaatctagtaagtgccaagtaacattacaaaataatattgaaatg
actacctgtatttttgttggcagaaatcctgaaaaatacataaagaatacaaaacatgaa
gatagctatactagctctcaaagaaataatttagaaaactctgatggtagtatgtcaagt
acaagtggcccagtttatattcataaaggtgacagtgatttacctgccgatcaaggcagt
aagtgtcctgagtcatgtacccaatatgcgagagaggaaaacacacaaattaaggaaaat
atatcagatttaacatgtttggaaattatgaaagctgaggaaacatgtatgaaatcttca
gataaaaaacaattaccttcagataagatggaacaaaatataaaagagtttaatatatcc
tttcagactgcaagtgggaaaaataccagagtctccaaagagtcattaaataaaagtgtg
aatatttttaatcgggaaacagatgaattgactgtcatttcagattctttgaattctaaa
attctccatggcataaataaggacaaaatgcatacttcatgtcacaagaaagcaatcagt
attaaaaaggtatttgaagaccatttcccaattgtaactgtcagtcaattaccagctcag
cagcatcctgaatatgaaatagaaagtaccaaagaacctactctgttgagttttcataca
gctagtgggaaaaaagtcaaaattatgcaggaatctttggacaaagtgaaaaaccttttt
gatgagacacaatatgttaggaaaactgccagttttagtcaaggatcaaaacccctgaag
gacagtaaaaaagaacttacattagcatatgagaaaattgaagtaactgcctcaaaatgt
gaagaaatgcagaactttgtctctaaggagactgaaatgctacctcagcaaaattatcat
atgtataggcaaactgaaaatctcaaaacatcaaatggtacctcttccaaagtacaagaa
aacatagaaaataatgtagaaaagaatcctagaatttgctgtatttgtcagtcctcttac
ccagtcactgaagattctgctttggcatattatacggaggacagtaggaaaacttgtgtc
agagagtcttctctatccaaaggcagaaaatggcttagagaacagggtgataagcttgga
acaagaaatactatcaaaattgagtgtgtaaaggaacacacagaagattttgcaggaaat
gcctcatatgaacatagtttggtcattatcagaactgaaattgatacaaatcatgtctct
gaaaaccaagtgtcaaccctccttagtgaccctaatgtgtgtcatagctatctatcccag
tctagtttttgtcattgtgatgacatgcataatgattcaggatatttcttaaaaaataaa
attgattctgacgttccgccagacatgaagaatgctgaaggcaataccatttcccccaga
gtatctgctacaaaagaaagaaatctacacccacaaactataaatgaatattgtgttcag
aaactggagactaatacttcaccacatgcaaataaagatgtagccattgacccatctctg
ctggattcaaggaattgtaaggtaggctcactcgtgtttattacagctcattcacaagaa
actgaaagaacaaaagagatagtcacagataactgttataaaatagttgagcaaaacaga
cagagtaaaccagacacttgccagacaagctgtcataaagtattggatgattcaaaggat
tttatatgtcctagctcttcaggtgatgtctgcataaactcacgtaaggatagtttttgt
cctcataatgaacaaattttacaacataaccaaagtatgtctggactgaagaaagctgca
acaccacctgttggtttggaaacttgggatacaagtaaatctataagagaacctccccag
gcagcccatccttcacgcacttatgggatttttagcacagcaagtggaaaagctatacaa
gtatcagatgcttcattagaaaaggcaaggcaagtgttttctgagatggatggtgatgct
aaacagttatcttccatggtgtcactggaaggtaatgaaaaaccacatcactctgtgaaa
agagaaaactctgtggtgcatagcacccagggtgtattgtcactcccaaaacccctccca
ggcaatgtcaattcatctgtattctctggatttagcactgcaggtggaaaactggtcaca
gtttcagaaagtgccttacacaaagttaaaggaatgttagaggagtttgatttgatcaga
actgaacatactctccagcattcacctatacctgaagacgtatcaaaaatacttcctcaa
ccttgtgctgaaatcagaaccccagaataccctgtaaactcaaaattgcagaaaacctac
aatgataaatccagcttaccaagtaattataaagaaagtggttcttcgggcaatactcaa
tctattgaagtttctctccaactctctcagatggagagaaaccaagacacacagttggta
ttaggaacaaaagtatcccatagtaaggctaatcttttgggaaaagaacaaactttaccc
caaaacataaaagtaaaaactgatgaaatgaaaacattttctgatgttcctgtgaaaaca
aatgtaggagagtattactccaaagagtcagagaactattttgaaacagaagcagtggag
agtgccaaagcttttatggaagatgatgagctgacagattctgaacagactcatgccaaa
tgctcactgtttacatgcccccaaaatgagactttgtttaattcgagaactaggaaaaga
ggaggagtgactgttgacgcagttggacaacccccaatcaaaagaagcttattaaatgaa
tttgacaggataatagaaagtaaaggaaaatccttaacaccttcaaaaagcactccagat
ggcacagtaaaagacagaagcttgttcacacaccacatgtctttagagccggttacctgt
ggacccttctgctcaagtaaagaaaggcaaggagcccagcgcccacatcttacctcacct
gctcaagagcttctgtctaaagggcatccctggagacactcagctttggaaaagtctcca
agcagtcctatagtttcaatcttaccggctcacgacgtttctgccacaagaaccgaaagg
accagacattcaggcaaatccaccaaagtcttcgtcccgcctttcaagatgaaatcacag
tttcacggagatgaacatttcaatagcaagaacgttaatttggagggaaagaaccaaaag
agcacagatggagacagggaagacgggaacgacagccatgttcgtcagtttaacaaagat
ttaatgtcaagccttcagagtgccagagacctacaggatatgcgaattaaaaacaaagaa
aggcgacatctccgtctgcagccaggcagtctgtatcttacaaagtcatccaccctgccc
cggatctccctgcaggctgcagtaggagacagggctccttctgcatgttctcctaagcag
ctctatatatacggcgtttctaaagagtgcataaacgttaatagcaaaaatgctgagtat
tttcagtttgatattcaggatcattttggtaaagaagatctgtgtgctggcaaaggcttt
cagttggcagatggtggatggctgatcccctccaatgatggcaaggctggaaaagaagaa
ttttatagggctctgtgtgacactccaggtgtggatccaaagcttatttctagcatctgg
gttgctaaccattacaggtggattgtatggaaactggcagctatggaatttgcttttcct
aaggaatttgctaatagatgcctaaacccagaaagagtgctgcttcaactgaaatacaga
tacgatgtggaaattgacaacagcaggagatcggctctaaagaagatactggagagggat
gacacagctgcaaaaacccttgttctctgtatttctgacatcatttcaccaagcacaaag
gtgtctgaaacttcaggcggtaaaactagtggtgaggatgccaacaaagtggacacgatc
gaactcacagatgggtggtacgctgtcagggcccagctagaccctccactcatggctctt
gtaaagagtggcaaactgactgtgggtcagaagatcattactcagggagcagagctggtg
ggctctcctgatgcctgtgcacctctggaagccccagactccctaaggctaaagatttct
gcaaacagcacaaggcctgctcgctggcacagcaggctggggttctttcgtgaccccagg
cccttccctctgcccttgtcctcactgttcagtgacggaggaaatgttggctgtgtggat
atcattgttcagagagtgtaccctttacagtgggtggagaagacagtgtctggattgtac
atatttcgtagtgagagagaagaggagaaggaagcactgagatttgcagaggcccagcag
aagaaactagaggccttgttcaccaaagtccacacagagtttaaagaccacgaagaagac
acaacacagcggtgtgtgctgtcccgcacactcacacggcagcaagtccatgctctgcag
gatggagcagagctctatgcagcagtgcagtatgcatcagacccagatcaccttgaggct
tgtttcagcgaagagcagctaagagccttgaacaactacagacaaatgctgaatgataag
aaacaagcgcggatccagtcagaattccggaaggccctggaatccgctgagaaagaggag
ggtttatcaagggatgttacaactgtgtggaagctgcgggttacaagctacaagaaaaag
gaaaaatcagctctgttgagtatctggcgtccatcatcagacttatcctccctgttaaca
gaaggaaagagatacagaatctatcatcttgcagtgtcaaaatcgaagagtaaatttgaa
cggcccagcatccagttaacagccacaaaaagaactcagtatcaacagctgccggtttcc
agtgagactttactccaggtttaccagcccagggagtcccttcacttcagcagactgtca
gacccagcctttcagcctccttgttctgaagtggatgtcgtaggagttgtagtttctgtt
gtaaaaccgataggtcttgctcctttggtctacctgtcagacgagtgccttaatttatta
gtggtgaaattcgggatagaccttaatgaagacataaagccacgtgtgctaattgccgca
agcaacctccagtgccagccagaatccacatcaggagtgccgaccttatttgctggccat
ttttccatattttctgccagtccaaaggaggcctactttcaggagaaagtcaacaacttg
aagcatgctattgagaatatcgatacattttacaaggaggcagaaaagaagcttatacac
gtgcttgagggagacagtcccaagtggtccacaccgaacaaagaccccacccgagagccc
catgcagcctccacttgctgtgcttcagatctccttggttcaggaggtcagttcctgagg
atttcacctactggtcagcaaagttatcaaagtcctttatcacactgcacactgaaaggg
aagtctatgcccctggctcactcagcccagatggcagcaaagtcttggagtggagagaac
gagattgatgacccaaaaacctgtcgaaaaagaagagccttggatttcctaagtcggctg
cccttaccgtccccggtcagtcccatctgtacctttgtctctccagctgcacagaaggct
tttcagccgccacggagctgtggcacgaaatacgcaacacctattaaaaaagaacccagt
tccccgcggaggagaacgccatttcagaagaccagtggcgtttctctgccggactgtgat
tcagtagctgatgaagaacttgccttgctcagcacccaggcccttacgcctgactccgtg
ggaggaaatgaacaagcgtttcccggtgattccacaaggaacccccagccagcacagagg
ccagaccagcaagtagggcccaggtccaggaaggagtctctcagggactgtagaggcgac
agcagtgagaaattagctgttgagtcttag

DBGET integrated database retrieval system