KEGG   Mus musculus (mouse): 12229Help
Entry
12229             CDS       T01002                                 

Gene name
Btk, AI528679, xid
Definition
(RefSeq) Bruton agammaglobulinemia tyrosine kinase
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04611  Platelet activation
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu05169  Epstein-Barr virus infection
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    12229 (Btk)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    12229 (Btk)
   04662 B cell receptor signaling pathway
    12229 (Btk)
   04664 Fc epsilon RI signaling pathway
    12229 (Btk)
  09158 Development
   04380 Osteoclast differentiation
    12229 (Btk)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    12229 (Btk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    12229 (Btk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12229 (Btk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     12229 (Btk)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  TEC family
   12229 (Btk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 Haspin_kinase SH3_10 Pkinase_fungal Kdo APH hSH3 SH3_4
Motif
Other DBs
NCBI-GeneID: 12229
NCBI-ProteinID: NP_038510
MGI: 88216
Ensembl: ENSMUSG00000031264
Vega: OTTMUSG00000019307
UniProt: P35991
LinkDB All DBs
Structure
PDB: 

Position
X E3; X 56.18 cM
AA seq 659 aa AA seqDB search
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVIPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEE
YFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPSFKILLSNILDVMDEES
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtgatactggagagcatctttctgaagcgctcccagcagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctgtttctcttgactgtacacaaactttcatactat
gaatatgactttgaacgtgggagaagaggcagtaagaaaggttcaatagatgttgagaag
atcacctgtgttgaaacagtaattcctgaaaaaaatcccccaccagaaagacagattccg
aggagaggtgaggagtctagtgaaatggaacagatttcaatcattgaaaggttcccgtac
ccattccaggttgtatatgatgaaggacctctctatgttttctccccaactgaagagctg
agaaagcgctggattcaccagctcaaaaatgtaatccggtacaatagtgacctggtacag
aaataccatccttgcttctggattgatggacagtatctctgctgctctcagacagccaag
aatgctatgggctgccaaattttggagaacaggaatggaagcttaaaacctgggagttct
catcgaaaaacgaaaaagcctcttccccctaccccagaggaagatcagatcttgaaaaaa
ccgcttcccccggagccaacagcagcaccaatctccacaaccgagctgaaaaaggtcgtg
gccctttatgattacatgccaatgaacgcaaatgacttacaattgcgaaagggcgaggag
tattttatcctggaggagagcaacctaccgtggtggcgagcacgagataaaaatgggcag
gaaggctacatcccaagtaactatatcactgaagctgaggactccatagagatgtatgag
tggtattccaagcacatgactcgaagtcaagctgagcaactgctaaagcaagaggggaaa
gaaggaggtttcattgtcagagactccagcaaagctggaaaatacaccgtgtctgtgttt
gctaaatctactggggagcctcaaggggtgatccgccattacgttgtgtgttccacgcca
cagagccagtattacctggctgagaaacacctcttcagcaccatccctgagctcattaac
taccatcaacacaactctgcaggcctcatatccaggctgaaatatcctgtgtctaaacaa
aacaaaaacgcgccttctactgcaggcctgggctatggatcatgggaaattgatccaaag
gacctcaccttcttgaaggagcttgggactggacaattcggtgtcgtgaaatatgggaag
tggaggggccaatatgatgtggccatcaagatgatcagagaaggttccatgtcggaggat
gaattcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtgcagttg
tatggcgtctgcaccaaacaacgccccatcttcatcatcaccgagtacatggctaatggc
tgcctcttgaactacctgagggagatgcggcaccgcttccagacacagcagctgcttgag
atgtgcaaagatgtctgtgaagcaatggaatacttggagtcgaagcagttccttcacaga
gacctggcagctcgaaactgtttggtaaacgatcaaggagttgtgaaagtatctgacttt
ggcctgtctaggtatgtccttgatgatgagtacaccagctctgtaggctccaagtttcca
gtccggtggtctccaccagaagtgcttatgtatagcaagttcagcagcaaatctgacatc
tgggcttttggggttttaatgtgggagatctactccctggggaagatgccgtatgagaga
tttactaacagtgagacagcagaacacattgctcaaggcttacgtctctacaggcctcat
ctggcatcagagagggtatataccatcatgtacagctgctggcacgagaaagcagatgaa
cgtcctagtttcaaaattctcttgagtaacattctagatgtgatggatgaagaatcctga

DBGET integrated database retrieval system