KEGG   Mus musculus (mouse): 12290Help
Entry
12290             CDS       T01002                                 

Gene name
Cacna1e, A430040I15, BII, Cach6, Cacnl1a6, Cav2.3, Cchra1, alpha1E
Definition
(RefSeq) calcium channel, voltage-dependent, R type, alpha 1E subunit
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12290 (Cacna1e)
   04020 Calcium signaling pathway
    12290 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12290 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12290 (Cacna1e)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12290 (Cacna1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF4710
Motif
Other DBs
NCBI-GeneID: 12290
NCBI-ProteinID: NP_033912
MGI: 106217
Ensembl: ENSMUSG00000004110
Vega: OTTMUSG00000049818
UniProt: A0A087WS83
LinkDB All DBs
Position
1 G3; 1 66.14 cM
AA seq 2273 aa AA seqDB search
MARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVR
QNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTP
MSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTH
FNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIG
LEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAV
LTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERE
RVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSR
TEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFY
WIVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSS
FNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSS
MKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDW
NEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEE
EEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWE
QRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALG
LGLEKCEEERISRGGSLKGDIGGLTSALDNQRSPLSLGKREPPWLPRSCHGNCDPIQQEA
GGGETVVTFEDRARHRQSQRRSRHRRVRTEGKDSASASRSRSASQERSLDEGVSVEGEKE
HEPHSSHRSKEPTIHEEERTQDLRRTNSLMVPRGSGLVGALDEAETPLVQPQPELEVGKD
AALTEQEAEGSSEQALLGDVQLDVGRGISQSEPDLSCMTANMDKATTESTSVTVAIPDVD
PLVDSTVVNISNKTDGEASPLKEAETKEEEEEVEKKKKQKKEKRETGKAMVPHSSMFIFS
TTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVF
TFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSL
RVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFY
CTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQV
LQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEC
SLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMM
KYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEI
ILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAML
FFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKG
CEPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPV
AEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPM
PKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKA
LPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLVVTDPSSMRRS
FSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGG
RERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSE
SSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLMRHTGGISPPPDGSEGGSPLASQAL
ESNSACLTESSNSLHPQQGQHPSPQHYISEPYLALHEDSHASDCGEEETLTFEAAVATSL
GRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6822 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgttggcaggccaggctcaggcgatggagactcg
gaccagagcaggaaccgacaaggaacccccgtcccggcctcggggccggcggccgcctac
aagcagtcaaaagcgcagagggcgcggactatggctttgtacaaccccataccagtccgg
cagaactgtttcacggtcaacagatccctgttcatcttcggagaagataacattgtcagg
aaatacgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatc
attgccaactgcatcgtcttggccctggagcagcatcttcctgaggatgacaagacccca
atgtctcgaagactggagaagacagaaccatatttcattgggatcttctgctttgaagct
gggatcaaaattgtggctctagggttcatcttccataagggttcatacctccgtaatggc
tggaatgtcatggacttcatcgtggtccttagtggcatcctggccactgcgggaacccac
ttcaacacccacgtggacctgcggaccctccgggctgtgcgtgtcctgaggcctttaaag
ctggtatcaggaatacctagcctgcagatcgtgctgaagtctatcatgaaggccatggtg
cctcttctgcagattggccttctgctcttctttgccatcctcatgtttgctatcattggc
ttggagttctacagtggcaagttgcatcgagcatgcttcatgaacaattcaggtattcta
gaggggtttgatcctcctcacccgtgtggtgtgcaaggctgcccggctggttatgaatgt
aaggactggatcggccccaatgacgggatcacccagtttgacaacatcctttttgccgtg
ctgactgtcttccaatgcatcactatggaagggtggaccactgtgctgtacaataccaat
gatgccttaggagccacctggaactggctgtacttcatccctctcatcatcatcggatcc
ttctttgttctcaacctcgtcctgggagtgctttccggggaatttgccaaagaaagagag
agagtggagaaccgaagagcgttcatgaagctccggcgccagcaacagattgagcgagaa
ttgaacggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaat
aaaaactcgggaacatcagccttggaagtgcttcgaagggcaaccatcaaaaggagccgg
acggaggccatgacccgagactccagcgatgagcactgcgttgatatctcttcagtgggc
acacctcttgccagagccagtatcaagagcacaaaagtagatggggcctcctatttccgg
cacaaggaacggcttctgcgcatctctatccgccacatggtcaagtcccaagtcttttac
tggatcgtcctgagtgttgtggctcttaatactgcctgtgtggccattgttcatcacaac
cagccacagtggctcactcacctcctctactatgcagagtttttgtttctgggactcttc
ctgttggagatgtccctgaagatgtatggcatggggccacgcctctattttcactcatcc
ttcaactgctttgattttggggtcacagtgggcagcatctttgaggttgtctgggcaatc
ttcagacctggcacatcttttggaatcagtgtcttacgagctctccggctcctaaggata
tttaaaataaccaagtattgggcatccctccggaatctggttgtctccttgatgagctcc
atgaagtctatcatcagcttactcttccttctcttcctcttcatcgttgtctttgctctc
ctgggaatgcagctctttggaggcaggtttaactttaatgatgggactccttcagctaat
tttgacaccttccctgcagctatcatgacagtgttccagatcctgacaggggaagactgg
aatgaggtgatgtacaatggcattcgctcccagggtggggtcagctcaggcatgtggtct
gccatctacttcattgtgctcaccttgtttggaaactacacgctgctaaatgtattcttg
gccatcgctgtggacaatctggccaatgcccaggaactgaccaaggatgagcaggaggaa
gaagaagccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtct
gctcccaacatgccttccattgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggaa
caacgcaccagccagctgaggaggcacatgcaaatgtctagccaagaagccctcaacaaa
gaggaggccccgccaatgaaccccctcaatccactcaacccactgagtcctctcaacccc
ctcaatgctcaccccagcctttatcggaggcccaggcccattgagggcctagccctaggt
ctgggtcttgaaaagtgtgaagaagaacgcatcagtcgtgggggctccctcaagggggac
atagggggcctgactagcgccctggacaaccagaggagccccttgtccttgggcaaacgg
gagccaccgtggctgcctagatcctgtcatggaaactgtgacccaatccagcaggaggct
gggggaggagagactgtggtgacttttgaggaccgggccaggcacaggcagagtcagagg
cgaagccggcatcgccgagtcaggactgagggcaaggactctgcctctgcatcccgaagc
aggtctgccagccaggagcggagtctggatgaaggggtgtccgttgagggggagaaggaa
catgagcctcacagcagccacaggagcaaagagccgaccatccacgaagaggagagaacc
caggacttaaggaggaccaacagtctgatggtccccaggggctctggactggtaggggct
cttgatgaagcagaaacacctctagtccagccccaacctgagctggaagtggggaaggat
gcagctctgacagagcaggaggctgaaggcagcagtgaacaagcccttcttggggacgta
cagctggatgtgggccggggcattagccagagtgaaccggatctctcctgcatgacagcc
aacatggacaaggctaccacggagagcaccagtgtcacggtcgccatccctgatgtggac
cccttggtggactcgacagtggtgaacattagcaacaagacggatggagaagccagtccc
ttgaaggaggcagagactaaagaggaagaagaagaggtagagaagaagaagaagcagaag
aaggagaagcgagagactggaaaagccatggtgccccatagctctatgttcatcttcagc
accactaacccgatccgcagggcctgccactacattgtgaacctacgctactttgaaatg
tgcattctcttggtgattgcggccagcagcattgccctggcagccgaggaccctgtacta
actaactcggagcgtaacaaagtcctgagatatttcgactatgttttcacaggagtgttt
acctttgagatggttataaagatgatagaccaaggcttgatcctgcaggatggatcatac
ttcagagacctctggaacatcctggactttgtagtagtggttggtgcattggtagcattt
gctctggcgaacgctttgggaaccaacaaggggagggatatcaagactatcaagtctctg
agggtacttcgagttctgcggccactgaaaaccatcaagcgcttgcccaagctgaaggct
gtgtttgactgcgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaag
ctcttcatgttcatctttgccgtcatcgctgttcagctattcaaaggaaagttcttttat
tgcactgacagttccaaggacacagagaaggagtgcataggcaactatgtagaccacgag
aaaaacaagatggaggtgaagggccgggaatggaagcgtcatgaattccactatgacaac
atcatctgggccctgcttaccctcttcacagtctctacaggggaaggatggcctcaggtt
ctgcagcactctgtagatgtgacagaggaggacagaggcccaagtcgcagcaaccgcatg
gagatgtccatcttttatgtggtctactttgtggtcttccctttcttctttgtcaatatc
ttcgtggctctcattatcatcaccttccaggagcaaggggacaagatgatggaggagtgt
agcctggagaagaatgagcgggcatgcatcgacttcgccattagtgccaaacctctcacc
cgctacatgccacagaacaggcacaccttccagtaccgtgtgtggcactttgtagtctcc
ccatcctttgagtataccatcatggccatgattgccttgaacactgtcgtgctgatgatg
aagtactactctgctccttgcacctatgagctcgccttaaagtacctgaacatcgccttc
actatggtgttttccctggagtgtgtcctaaaggtcattgctttcggcttcctgaactat
ttccgagatacctggaacatctttgacttcatcacggtgatcggcagtatcacagaaatt
atcctgacagatagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctc
ttccgagctgcacggctcataaagcttctgagacagggctacaccatccgcatcttactg
tggaccttcgtgcagtcctttaaggctcttccctacgtctgccttctcattgccatgctt
ttcttcatctacgccatcattgggatgcaggtgtttggaaacataaagttagatgaggag
agtcacatcaaccggcacaacaacttccggagtttctttggatccctcatgctgcttttc
aggagtgccacgggggaggcttggcaggagattatgctgtcctgtctcggtgagaagggt
tgtgagcctgacaccactgcaccctcagggcagaatgagagtgagcgctgtggcactgac
ctggcctacgtttattttgtctccttcatcttcttctgctccttcctgatgctcaacctg
ttcgtggctgtcatcatggacaactttgagtacctgactcgagattcctccatcctgggg
cctcaccacttagatgagtttgtccgtgtctgggcagaatatgacagagcagcatgtggc
cgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctc
ggcaagagatgtccctccaaagtggcctataagaggctggtcctgatgaacatgccagtg
gctgaggacatgacagtccacttcacctccacacttatggctctgatccggacagctctg
gacattaaaatcgccaaaggtggtgcagacagacagcagctagactcggagctgcaaaaa
gagaccctggccatttggcctcacctgtcccaaaagatgttggatctgcttgtgcccatg
cccaaagcctctgacctgactgtgggcaagatctatgcagcaatgatgatcatggactac
tataaacagagtaaggtaaagaaacagagacagcagctggaagaacagaaaaatgcaccc
atgttccagcgcatggagccctcatcactgcctcaggagatcattgctaatgccaaagcc
ctgccttatctccagcaggaccctgtttctggcctgagtggtcggagtggatacccttca
atgagtccactctcccctcaagaaatattccagttggcttgtatggacccagcggatgat
ggacaattccaggaacaacaatctctggtggtaacagaccctagctctatgcgacgttca
ttttctacaattcgggataagcgttcaaattcctcctggttggaggagttctccatggaa
cgcagcagtgaaaacacttacaagtcgcggcgcagaagttaccattcctccctgaggctg
tcagcacaccgcctgaattctgactctggtcacaagtctgacactcaccgatcaggaggc
agggagagaggccgatccaaagaacgaaagcacctcctctctccagatgtctcccgctgc
aattctgaagagcgagggacccaggccgactgggagtccccagaacgtcgccagtccagg
tcacccagtgaaggaaggtcacagacccccaatagacagggtaccggttccctaagtgag
agctccatcccctctatttccgacaccagcaccccaagacgaagccgtcgccagctccca
cctgtgccaccaaagcctcgtcccctcctctcctacagctccctgatgagacacactggc
ggcatctctccacctcctgatggaagtgagggtggatccccactggcctctcaagctctg
gagagcaacagcgcttgcctgaccgagtcttccaactccttgcacccccagcagggccag
catccttccccacagcactacatctccgagccctatctggccctccatgaagactcccac
gcctcagactgtggcgaggaggagacactcacctttgaggcagccgtagccactagcttg
ggccggtccaataccattggctctgcgccacccctacggcacagctggcagatgcctaat
gggcactatcggcggcggaggcgtggggggcctgggcctggcatgatgtgtggagctgtc
agtgacctcctgagtgacacggaagaagacgataagtgctag

DBGET integrated database retrieval system