KEGG   Mus musculus (mouse): 12326Help
Entry
12326             CDS       T01002                                 

Gene name
Camk4, A430110E23Rik, AI666733, CaMKIV, CaMKIV/Gr, D18Bwg0362e
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04211  Longevity regulating pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04921  Oxytocin signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05214  Glioma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    12326 (Camk4)
   04020 Calcium signaling pathway
    12326 (Camk4)
   04024 cAMP signaling pathway
    12326 (Camk4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    12326 (Camk4)
   04925 Aldosterone synthesis and secretion
    12326 (Camk4)
  09156 Nervous system
   04725 Cholinergic synapse
    12326 (Camk4)
   04720 Long-term potentiation
    12326 (Camk4)
   04722 Neurotrophin signaling pathway
    12326 (Camk4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12326 (Camk4)
  09149 Aging
   04211 Longevity regulating pathway
    12326 (Camk4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    12326 (Camk4)
  09165 Substance dependence
   05031 Amphetamine addiction
    12326 (Camk4)
   05034 Alcoholism
    12326 (Camk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12326 (Camk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     12326 (Camk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   12326 (Camk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 12326
NCBI-ProteinID: NP_033923
MGI: 88258
Ensembl: ENSMUSG00000038128
UniProt: Q8BGR3
LinkDB All DBs
Position
18 B1; 18 18.15 cM
AA seq 469 aa AA seqDB search
MLKVTVPSCPSSPCSSVTASTENLVPDYWIDGSNRDPLGDFFEVESELGRGATSIVYRCK
QKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGG
ELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIA
DFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDE
RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKA
ANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTSIQENHKASSDPPSTQD
AKDSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQSEEVEKDAGVKEEETSSMVPQDPED
ELETDDPEMKRDSEEKLKSVEEEMDPMTEEEAPDAGLGVPQQDAIQPEY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgtccctcctcgccctgctcctcggtcaccgccagt
actgagaacctcgtcccggattactggatcgacggctctaaccgagatcctctgggcgat
ttcttcgaggtggagtcagagctgggacggggtgctacatccattgtgtacagatgcaaa
cagaaggggacccagaagccctatgctctcaaagtgttaaagaaaacagtggacaagaag
attgtgagaacagaaataggagttctcctgcgtctctcacacccgaacatcataaaactc
aaggaaatattcgaaacccccacagaaatcagcctggtccttgagctggtcacaggagga
gaactgtttgacaggattgtggagaagggatactacagtgagcgcgatgcggctgacgcg
gtgaagcagatcctggaggccgttgcttacctgcatgaaaatgggattgtccatcgtgac
ctcaaaccagagaatcttctttatgcaactccagcccctgatgcacccctcaaaattgct
gattttggactttcaaaaattgtggaacatcaagtgctcatgaagacagtgtgtggaacc
ccggggtactgcgcacctgagattctccgaggctgtgcctacggacctgaggtggacatg
tggtctgtaggaataatcacctacatcctactttgtggatttgaaccattctatgacgag
cgaggtgatcagttcatgttcaggagaattctgaattgtgaatattactttatctccccc
tggtgggatgaagtgtctttaaatgccaaggacttggtcaaaaagctcattgttttggat
cccaagaaacggctgactacatttcaagccctccaacacccatgggtcacaggtaaagcg
gccaactttgttcacatggacactgctcagaagaaacttcaagaattcaatgctcggcgc
aagcttaaggcagcggtgaaggctgtggtggcctcttctcggctgggaagtgccagcagt
agccacaccagcatccaagagaaccacaaggccagctcggatccaccttcaacccaagat
gccaaggacagcacagatcttctgggaaagaaaatgcaagaggaggaccaagaggaggac
caagtggaggccgaggcttcagccgatgagatgaggaagctgcagtccgaggaggtggag
aaagatgcaggtgtaaaagaggaggagacctccagtatggtgcctcaggatccagaggat
gagctggaaacagatgacccagagatgaagagggattcagaggagaagctgaagagtgtg
gaggaagaaatggaccccatgactgaggaggaagcccctgacgcgggacttggggttcca
cagcaggatgcgattcagccagagtactaa

DBGET integrated database retrieval system