KEGG   Mus musculus (mouse): 12367Help
Entry
12367             CDS       T01002                                 

Gene name
Casp3, A830040C14Rik, AC-3, CASP-3, CC3, CPP-32, CPP32, Caspase-3, Lice, SCA-1, Yama, mldy
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04650  Natural killer cell mediated cytotoxicity
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04726  Serotonergic synapse
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05222  Small cell lung cancer
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12367 (Casp3)
   04668 TNF signaling pathway
    12367 (Casp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12367 (Casp3)
   04215 Apoptosis - multiple species
    12367 (Casp3)
   04115 p53 signaling pathway
    12367 (Casp3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    12367 (Casp3)
   04657 IL-17 signaling pathway
    12367 (Casp3)
  09156 Nervous system
   04726 Serotonergic synapse
    12367 (Casp3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12367 (Casp3)
   05206 MicroRNAs in cancer
    12367 (Casp3)
   05205 Proteoglycans in cancer
    12367 (Casp3)
   05203 Viral carcinogenesis
    12367 (Casp3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12367 (Casp3)
   05222 Small cell lung cancer
    12367 (Casp3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12367 (Casp3)
   05012 Parkinson disease
    12367 (Casp3)
   05014 Amyotrophic lateral sclerosis (ALS)
    12367 (Casp3)
   05016 Huntington disease
    12367 (Casp3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12367 (Casp3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12367 (Casp3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    12367 (Casp3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12367 (Casp3)
   05134 Legionellosis
    12367 (Casp3)
   05152 Tuberculosis
    12367 (Casp3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12367 (Casp3)
   05162 Measles
    12367 (Casp3)
   05164 Influenza A
    12367 (Casp3)
   05161 Hepatitis B
    12367 (Casp3)
   05160 Hepatitis C
    12367 (Casp3)
   05168 Herpes simplex virus 1 infection
    12367 (Casp3)
   05163 Human cytomegalovirus infection
    12367 (Casp3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12367 (Casp3)
   05169 Epstein-Barr virus infection
    12367 (Casp3)
   05165 Human papillomavirus infection
    12367 (Casp3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12367 (Casp3)
   05145 Toxoplasmosis
    12367 (Casp3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    12367 (Casp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12367 (Casp3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     12367 (Casp3)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C14: caspase family
   12367 (Casp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 12367
NCBI-ProteinID: NP_001271338
MGI: 107739
Ensembl: ENSMUSG00000031628
Vega: OTTMUSG00000061297
UniProt: P70677
LinkDB All DBs
Position
8 B1.1; 8 26.39 cM
AA seq 277 aa AA seqDB search
MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTG
MSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILS
HGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDE
EMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaacaaaacctcagtggattcaaaatccattaataattttgaagtaaagacc
atacatgggagcaagtcagtggactctgggatctatctggacagtagttacaaaatggat
tatcctgaaatgggcatatgcataataattaataataagaacttccataagagcactgga
atgtcatctcgctctggtacggatgtggacgcagccaacctcagagagacattcatgggc
ctgaaataccaagtcaggaataaaaatgatcttactcgtgaagacattttggaattaatg
gatagtgtttctaaggaagatcatagcaaaaggagcagctttgtgtgtgtgattctaagc
catggtgatgaaggggtcatttatgggacaaatgggcctgttgaactgaaaaagttgact
agcttcttcagaggcgactactgccggagtctgactggaaagccgaaactcttcatcatt
caggcctgccggggtacggagctggactgtggcattgagacagacagtgggactgatgag
gagatggcttgccagaagataccggtggaggctgacttcctgtatgcttactctacagca
cctggttactattcctggagaaattcaaaggacgggtcgtggttcatccagtccctttgc
agcatgctgaagctgtacgcgcacaagctagaatttatgcacattctcactcgcgttaac
aggaaggtggcaacggaattcgagtccttctccctggactccactttccacgcaaagaaa
cagatcccgtgtattgtgtccatgctcacgaaagaactgtacttttatcactag

KEGG   Mus musculus (mouse): 12369Help
Entry
12369             CDS       T01002                                 

Gene name
Casp7, AI314680, CMH-1, ICE-IAP3, Mch3, caspase-7, mCASP-7
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04668  TNF signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12369 (Casp7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12369 (Casp7)
   04215 Apoptosis - multiple species
    12369 (Casp7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12369 (Casp7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12369 (Casp7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12369 (Casp7)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12369 (Casp7)
   05134 Legionellosis
    12369 (Casp7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12369 (Casp7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     12369 (Casp7)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C14: caspase family
   12369 (Casp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 12369
NCBI-ProteinID: NP_031637
MGI: 109383
Ensembl: ENSMUSG00000025076
UniProt: P97864 Q4FJQ4
LinkDB All DBs
Position
19 D2; 19 51.84 cM
AA seq 303 aa AA seqDB search
MTDDQDCAAELEKVDSSSEDGVDAKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLY
RMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQ
DLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FSR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgatcaggactgtgctgcggagctggaaaaggtggattcttccagcgaagac
ggagttgacgccaagccagaccgctcctctatcatctcctctattctcttgaagaagaag
agaaatgcctctgcgggccccgtcaggaccggccgggaccgagtgcccacttatctgtac
cgcatggatttccagaagatgggtaaatgcatcatcataaacaacaagaacttcgacaaa
gcgacaggtatggacgtccggaatgggacggacaaagatgcaggggccctcttcaagtgc
ttccaaaacctgggttttgaagtaaccgtccacaatgactgctcttgtgcaaagatgcaa
gatctgcttagaaaagcctctgaggaggaccacagcaactcggcctgcttcgcctgcgtc
ctgctgagccacggggaagaggacctgatttacgggaaagatggcgtgacacccataaag
gatctgacagctcattttaggggagaccgatgcaaaaccctgttagagaaacccaaactc
ttcttcattcaggcatgccgagggacggagctcgatgatggaatccaggctgactcgggg
cccatcaacgacattgacgctaatccccgcaacaagatcccggtggaagccgacttcctc
tttgcttactccacggttccaggttattactcatggaggaacccagggaaaggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatggcaaggacctcgagatcatgcag
atcctgaccagggtgaacgacagggtggccaggcacttcgagtcccagtctgatgatcca
cgcttcaacgagaagaagcagatcccgtgtatggtgtccatgctcaccaaagagctgtac
ttcagccgttga

DBGET integrated database retrieval system