KEGG   Mus musculus (mouse): 12368Help
Entry
12368             CDS       T01002                                 

Gene name
Casp6, CASP-6, Mch2
Definition
(RefSeq) caspase 6
  KO
K04396  caspase 6 [EC:3.4.22.59]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12368 (Casp6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    12368 (Casp6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.59  caspase-6
     12368 (Casp6)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12368 (Casp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 12368
NCBI-ProteinID: NP_033941
MGI: 1312921
Ensembl: ENSMUSG00000027997
Vega: OTTMUSG00000028845
UniProt: O08738 Q3TPJ9
LinkDB All DBs
Position
3; 3 G3
AA seq 276 aa AA seqDB search
MTETDGFYKSREVFDPAEQYKMDHKRRGVALIFNHERFFWHLTLPERRGTNADRDNLTRR
FSDLGFEVKCFNDLRAEELLLKIHEVSTSSHIDADCFICVFLSHGEGNHVYAYDAKIEIQ
TLTGLFKGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDMVDHQTDKLDNVTQVDAASVY
TLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQ
RRVDFCKDPDAIGKKQVPCFASMLTKKLHFCPKPSK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaccgatggcttctacaaaagtagggaagtgttcgatccagccgagcagtac
aagatggaccacaagaggagaggagttgccctcatcttcaatcacgagaggttcttttgg
cacctgaccctcccagagaggcggggcaccaacgcagacagagacaacctgactcgcagg
ttttcagatctaggatttgaagtgaaatgctttaacgacctcagagcagaagaactcctg
ctcaaaattcacgaggtgtcgacttcaagccacatagatgccgattgcttcatctgtgtc
ttcctgagccatggggaaggcaaccacgtttacgcatacgacgccaaaattgaaattcag
acgttgactggcttgttcaaaggagacaagtgtcagagcctggttggaaaacccaagata
tttatcatccaggcctgtcggggtagccagcatgacgtacccgtggttcccctggacatg
gtggatcaccagacagacaagctggacaacgtgacccaggtggatgctgcgtccgtgtac
acgctgccggcaggggcagacttcctcatgtgctactctgtcgcagaagggtattactct
caccgagaaactgtgaatggctcctggtacattcaggatttgtgtgagatgctggcgagg
tacggcagttccctggagttcacggagctgctcacgctggtgaacagaaaggtctctcag
cgccgcgtggacttctgcaaagacccggatgcaatcggcaagaagcaggtgccctgcttc
gcctcaatgctgaccaaaaagctgcatttctgtcccaaacctagcaagtag

DBGET integrated database retrieval system