KEGG   Mus musculus (mouse): 12370
Entry
12370             CDS       T01002                                 

Gene name
Casp8, CASP-8, Casp, FLI, FLICE, MAC, MACH, Mch5
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05134  Legionellosis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12370 (Casp8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12370 (Casp8)
   04215 Apoptosis - multiple species
    12370 (Casp8)
   04217 Necroptosis
    12370 (Casp8)
   04115 p53 signaling pathway
    12370 (Casp8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    12370 (Casp8)
   04621 NOD-like receptor signaling pathway
    12370 (Casp8)
   04622 RIG-I-like receptor signaling pathway
    12370 (Casp8)
   04625 C-type lectin receptor signaling pathway
    12370 (Casp8)
   04657 IL-17 signaling pathway
    12370 (Casp8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12370 (Casp8)
   05203 Viral carcinogenesis
    12370 (Casp8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12370 (Casp8)
   05016 Huntington disease
    12370 (Casp8)
   05022 Pathways of neurodegeneration - multiple diseases
    12370 (Casp8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12370 (Casp8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12370 (Casp8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    12370 (Casp8)
   05134 Legionellosis
    12370 (Casp8)
   05152 Tuberculosis
    12370 (Casp8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12370 (Casp8)
   05161 Hepatitis B
    12370 (Casp8)
   05160 Hepatitis C
    12370 (Casp8)
   05164 Influenza A
    12370 (Casp8)
   05162 Measles
    12370 (Casp8)
   05168 Herpes simplex virus 1 infection
    12370 (Casp8)
   05163 Human cytomegalovirus infection
    12370 (Casp8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12370 (Casp8)
   05169 Epstein-Barr virus infection
    12370 (Casp8)
   05165 Human papillomavirus infection
    12370 (Casp8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    12370 (Casp8)
   05142 Chagas disease
    12370 (Casp8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    12370 (Casp8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12370 (Casp8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     12370 (Casp8)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C14: caspase family
   12370 (Casp8)
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 12370
NCBI-ProteinID: NP_001073595
MGI: 1261423
Ensembl: ENSMUSG00000026029
Vega: OTTMUSG00000047216
UniProt: O89110 Q3U607
LinkDB
Position
1 C1.3; 1 29.19 cM
AA seq 480 aa
MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLS
FLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVMLFKLSEEVSELELRSF
KFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICDQVNKSLLGKIEDYER
SSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESRTSDKVYQMKNKPRGYCLI
INNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEG
YQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQ
ACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNG
TWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatttccagagttgtctttatgctattgctgaagaactgggcagtgaagacctggct
gccctcaagttcctgtgcttggactacatcccacacaagaagcaggagaccatcgaggat
gcccagaagctatttctgaggctgcgggaaaaggggatgttggaggaaggcaatctgtct
ttcctgaaagagctgcttttccacatcagtcggtgggacctgctggtcaacttcctagac
tgcaaccgagaggagatggtgagagagctgcgggatccagacaatgcccagatttctccc
tacagggtcatgctctttaagctctcagaagaagtgagcgagttggaattgagatctttt
aagttccttttgaacaatgagatccccaaatgtaagctggaagatgacttgagcctgctt
gaaatttttgtagaaatggagaagaggaccatgctggcagaaaataacttggaaacccta
aaatcaatctgtgaccaggtcaacaagagcctgctggggaagatcgaggattatgaaaga
tcaagcacagagagaagaatgagccttgaaggaagggaagagttgccaccttcagttttg
gatgagatgagcctcaaaatggcggaactgtgtgactcgccaagagaacaagacagtgag
tcacggacttcagacaaagtttaccaaatgaagaacaaacctcggggatactgtctgatc
atcaacaatcatgatttcagcaaggcccgggaagacataacccaactccgaaaaatgaag
gacagaaaaggaacagactgtgataaagaggctctgagtaagacctttaaggagcttcat
tttgagatagtatcttacgacgactgcactgcaaatgaaatccacgagattctagaaggc
taccaaagcgcagaccacaagaacaaagactgcttcatctgctgtatcctatcccacggt
gacaagggtgtcgtctatggaacggatgggaaggaggcctccatctatgacctgacatct
tacttcactggttcaaagtgcccttccctgtctgggaaacccaagatctttttcattcag
gcttgccaaggaagtaacttccagaaaggagtgcctgatgaggcaggcttcgagcaacag
aaccacactttagaagtggattcatcatctcacaagaactatattccggatgaggcagac
tttctgctgggaatggctacggtgaagaactgcgtttcctaccgagatcctgtgaatgga
acctggtatattcagtcactttgccagagcctgagggaaagatgtcctcaaggagatgac
attcttagcatcctgactggcgtgaactatgacgtgagcaataaagacgacaggaggaac
aagggaaagcagatgccacagcccaccttcacactacggaagaagctcttcttccctccc
taa

DBGET integrated database retrieval system