KEGG   Mus musculus (mouse): 12370Help
Entry
12370             CDS       T01002                                 

Gene name
Casp8, CASP-8, FLICE, MACH, Mch5
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05134  Legionellosis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12370 (Casp8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12370 (Casp8)
   04215 Apoptosis - multiple species
    12370 (Casp8)
   04217 Necroptosis
    12370 (Casp8)
   04115 p53 signaling pathway
    12370 (Casp8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    12370 (Casp8)
   04621 NOD-like receptor signaling pathway
    12370 (Casp8)
   04622 RIG-I-like receptor signaling pathway
    12370 (Casp8)
   04625 C-type lectin receptor signaling pathway
    12370 (Casp8)
   04657 IL-17 signaling pathway
    12370 (Casp8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12370 (Casp8)
   05203 Viral carcinogenesis
    12370 (Casp8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12370 (Casp8)
   05016 Huntington disease
    12370 (Casp8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    12370 (Casp8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12370 (Casp8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    12370 (Casp8)
   05152 Tuberculosis
    12370 (Casp8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12370 (Casp8)
   05162 Measles
    12370 (Casp8)
   05164 Influenza A
    12370 (Casp8)
   05161 Hepatitis B
    12370 (Casp8)
   05160 Hepatitis C
    12370 (Casp8)
   05168 Herpes simplex virus 1 infection
    12370 (Casp8)
   05163 Human cytomegalovirus infection
    12370 (Casp8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12370 (Casp8)
   05169 Epstein-Barr virus infection
    12370 (Casp8)
   05165 Human papillomavirus infection
    12370 (Casp8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    12370 (Casp8)
   05142 Chagas disease (American trypanosomiasis)
    12370 (Casp8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    12370 (Casp8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12370 (Casp8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     12370 (Casp8)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C14: caspase family
   12370 (Casp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED PYRIN
Motif
Other DBs
NCBI-GeneID: 12370
NCBI-ProteinID: NP_001073595
MGI: 1261423
Ensembl: ENSMUSG00000026029
Vega: OTTMUSG00000047216
UniProt: O89110 Q3U607
LinkDB All DBs
Position
1 C1.3; 1 29.19 cM
AA seq 480 aa AA seqDB search
MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLS
FLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVMLFKLSEEVSELELRSF
KFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICDQVNKSLLGKIEDYER
SSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESRTSDKVYQMKNKPRGYCLI
INNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEG
YQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQ
ACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNG
TWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatttccagagttgtctttatgctattgctgaagaactgggcagtgaagacctggct
gccctcaagttcctgtgcttggactacatcccacacaagaagcaggagaccatcgaggat
gcccagaagctatttctgaggctgcgggaaaaggggatgttggaggaaggcaatctgtct
ttcctgaaagagctgcttttccacatcagtcggtgggacctgctggtcaacttcctagac
tgcaaccgagaggagatggtgagagagctgcgggatccagacaatgcccagatttctccc
tacagggtcatgctctttaagctctcagaagaagtgagcgagttggaattgagatctttt
aagttccttttgaacaatgagatccccaaatgtaagctggaagatgacttgagcctgctt
gaaatttttgtagaaatggagaagaggaccatgctggcagaaaataacttggaaacccta
aaatcaatctgtgaccaggtcaacaagagcctgctggggaagatcgaggattatgaaaga
tcaagcacagagagaagaatgagccttgaaggaagggaagagttgccaccttcagttttg
gatgagatgagcctcaaaatggcggaactgtgtgactcgccaagagaacaagacagtgag
tcacggacttcagacaaagtttaccaaatgaagaacaaacctcggggatactgtctgatc
atcaacaatcatgatttcagcaaggcccgggaagacataacccaactccgaaaaatgaag
gacagaaaaggaacagactgtgataaagaggctctgagtaagacctttaaggagcttcat
tttgagatagtatcttacgacgactgcactgcaaatgaaatccacgagattctagaaggc
taccaaagcgcagaccacaagaacaaagactgcttcatctgctgtatcctatcccacggt
gacaagggtgtcgtctatggaacggatgggaaggaggcctccatctatgacctgacatct
tacttcactggttcaaagtgcccttccctgtctgggaaacccaagatctttttcattcag
gcttgccaaggaagtaacttccagaaaggagtgcctgatgaggcaggcttcgagcaacag
aaccacactttagaagtggattcatcatctcacaagaactatattccggatgaggcagac
tttctgctgggaatggctacggtgaagaactgcgtttcctaccgagatcctgtgaatgga
acctggtatattcagtcactttgccagagcctgagggaaagatgtcctcaaggagatgac
attcttagcatcctgactggcgtgaactatgacgtgagcaataaagacgacaggaggaac
aagggaaagcagatgccacagcccaccttcacactacggaagaagctcttcttccctccc
taa

DBGET integrated database retrieval system