KEGG   Mus musculus (mouse): 12385Help
Entry
12385             CDS       T01002                                 

Gene name
Ctnna1, 2010010M04Rik, AA517462, AI988031, Catna1
Definition
(RefSeq) catenin (cadherin associated protein), alpha 1
  KO
K05691  catenin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04670  Leukocyte transendothelial migration
mmu05100  Bacterial invasion of epithelial cells
mmu05200  Pathways in cancer
mmu05213  Endometrial cancer
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    12385 (Ctnna1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    12385 (Ctnna1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12385 (Ctnna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12385 (Ctnna1)
  09162 Cancer: specific types
   05226 Gastric cancer
    12385 (Ctnna1)
   05213 Endometrial cancer
    12385 (Ctnna1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    12385 (Ctnna1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12385 (Ctnna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    12385 (Ctnna1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     12385 (Ctnna1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin I_LWEQ FUSC
Motif
Other DBs
NCBI-GeneID: 12385
NCBI-ProteinID: NP_033948
MGI: 88274
Ensembl: ENSMUSG00000037815
UniProt: P26231 Q545R0
LinkDB All DBs
Structure
PDB: 

Position
18 B1; 18 18.89 cM
AA seq 906 aa AA seqDB search
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDAAQHQGGSGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgtccacgcaggcaacataaacttcaaatgggaccccaaaagtctggagatt
aggactctggctgttgaaagactgttggagcctcttgttacacaggttacaaccctggta
aacaccaatagtaaagggccgtctaataaaaagagaggccgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggaaaagggggataaaattgca
aaagagagccagtttctcaaggaggagcttgtggttgctgtagaagatgttcgaaaacaa
ggagatttgatgaagagcgctgctggggagtttgcagatgatccatgctcttctgtgaag
cgaggcaacatggtccgggcagctcgagctttgctctctgccgtcacccggctgctgatt
ctggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atattgaaactgaggaatgctggcaatgaacaagacttagggatacagtacaaagctctg
aaaccagaagtagataagctgaacatcatggcagcaaaaagacaacaggaactaaaagat
gtgggcaatcgtgatcagatggctgcagctagaggaatcctgcagaaaaatgttccaatc
ctctatactgcatcccaggcatgtctacaacaccctgatgttgcagcctataaggccaac
cgggacttgatatacaagcagctgcagcaggccgtcacaggaatttctaatgcagcccag
gctactgcatcagatgatgctgcccagcaccagggtggcagtggcggagagctggcatac
gctctcaacaactttgataaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccgtccctggaggagcgcctggaaagcattattagtggggctgccctgatggct
gactcatcctgcacacgtgatgaccgtcgggagcgcattgtggcagagtgtaatgctgtc
cgccaggctctacaggacctgctctcagaatacatgggcaacgctggacgtaaagaaaga
agtgatgcactcaactctgcaatagataaaatgaccaagaagaccagggacttgcgtaga
cagcttcgcaaagctgtcatggaccacgtatcagattctttcctggagaccaatgtccct
ctattagtactgattgaagctgcaaagaatggaaatgagaaagaagttaaggaatatgcc
caagtttttcgtgaacatgccaacaaactgattgaggttgccaacctggcctgttcaatc
tccaacaatgaagaaggcgtgaagcttgtccgaatgtctgcaagccagttagaagcgctg
tgtcctcaggttatcaatgctgcattggcgttggcagcaaagccgcagagtaaactggcc
caagagaacatggatctttttaaagagcaatgggaaaagcaagtccgtgttctcacagat
gctgttgatgacattacttccatcgatgacttcttggctgtctcagagaaccacatttta
gaagatgtgaacaagtgtgttattgctctccaagagaaagacgtggatgggctggatcgc
actgccggtgccatccgaggccgggcagcccgagtcattcatgtagtcacctcagagatg
gacaactacgagccaggagtttacacagagaaggttctggaagccaccaagctcctctcc
aacacagtcatgccgcgcttcactgagcaggtggaagcagctgtggaagccctcagctcg
gacccggcccagcccatggatgagaatgagttcatcgacgcctcccgtctggtgtacgac
ggcatccgggacatccggaaagcagtgctgatgatcaggacccccgaggagttggacgac
tctgacttcgagactgaagactttgatgtcagaagcaggaccagtgtccagacagaagat
gaccagctgatagctggccagagcgcccgggcgatcatggctcagcttcctcaggagcaa
aaagcaaagattgcagaacaggtggccagtttccaggaagagaagagcaagctggatgct
gaagtgtccaagtgggatgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgatcatgatggagatgaccgacttcacccgaggcaaaggtccactcaaaaacacctct
gacgtgatcagtgctgccaagaaaattgcggaggcgggatccaggatggacaagctcggc
cggaccatcgcagaccattgcccagactcggcatgcaagcaggacctgctggcctacctt
cagcgcatcgctctctactgccaccagctcaacatctgcagcaaagtcaaggctgaagta
cagaaccttggtggagagctggtcgtctctggggtggacagcgccatgtccctgatccag
gcggccaagaacttgatgaatgctgttgtgcagacagtgaaggcgtcctacgtggcttcc
accaaataccagaagtcacaggggatggcttccttgaaccttcctgctgtgtcatggaag
atgaaggcccctgagaagaagccgttggtgaagagagagaagcaggatgagacgcagacc
aagattaaacgagcttctcagaagaaacacgtgaacccagtgcaggccctgagcgagttc
aaagccatggacagcatctga

KEGG   Mus musculus (mouse): 12386Help
Entry
12386             CDS       T01002                                 

Gene name
Ctnna2, AI481747, Catna, Catna2, cdf, chp
Definition
(RefSeq) catenin (cadherin associated protein), alpha 2
  KO
K05691  catenin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04670  Leukocyte transendothelial migration
mmu05100  Bacterial invasion of epithelial cells
mmu05200  Pathways in cancer
mmu05213  Endometrial cancer
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    12386 (Ctnna2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    12386 (Ctnna2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12386 (Ctnna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12386 (Ctnna2)
  09162 Cancer: specific types
   05226 Gastric cancer
    12386 (Ctnna2)
   05213 Endometrial cancer
    12386 (Ctnna2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    12386 (Ctnna2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12386 (Ctnna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    12386 (Ctnna2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     12386 (Ctnna2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin CorA
Motif
Other DBs
NCBI-GeneID: 12386
NCBI-ProteinID: NP_001103234
MGI: 88275
Ensembl: ENSMUSG00000063063
Vega: OTTMUSG00000034530
UniProt: Q61301
LinkDB All DBs
Structure
PDB: 

Position
6 C3; 6 33.54 cM
AA seq 953 aa AA seqDB search
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISSAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVN
SPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggcaacttcacctattattttaaaatgggatcccaaaagtttggaaatccgg
acactcacagtggaaagactattggagccacttgtgacacaggtgacaacacttgtcaac
acaagcaacaaaggtccgtctggtaaaaagaaagggaggtcaaagaaagcccatgtgctg
gcagcatctgtagaacaagctactcagaacttcctggaaaagggtgaacagatcgctaag
gagagccaagacctcaaagaagagttagtggctgctgtagaggatgtgcggaagcaaggt
gagacaatgcggattgcctcctcagagtttgcagatgacccttgctcttctgtcaagcgt
ggcaccatggtgcgtgcagcacgggctctgctatcggctgtgacacgcttgctcatcctg
gccgacatggcagatgtcatgaggcttttatcgcatctgaaaattgtcgaggaggccttg
gaagcagtcaaaaatgccacaaatgaacaagaccttgcaaaccgatttaaagagtttggg
aaagagatggtgaaactgaactatgtagcagcaagacggcagcaggagctcaaggaccct
cactgtagggatgagatggctgcagcccgtggagccctgaagaagaatgccaccatgctg
tacacagcctcccaagccttcctccggcatccagatgttgctgctacaagagccaaccga
gattatgtatttaaacaagtccaagaggccatagctggcatctccagtgctgctcaggcc
acctcccccaccgatgaagccaaaggccacacaggcatcggcgagctggctgcagccctg
aatgagtttgataataagatcatcctggaccccatgacattcagcgaggccaggttccga
ccatccctggaggagagactggagagcatcatcagtggggctgctctcatggcagattcc
tcctgcacacgtgatgaccgccgtgagcgtattgtggccgagtgcaatgcagttcgacag
gcactccaggacctgctaagcgagtacatgaataacactggaaggaaagagaaaggagac
cctctcaacattgcgattgacaagatgaccaagaaaacaagagatctgaggagacagctt
cggaaagctgtgatggatcacatctcagattctttcttggaaaccaatgtccccttgctg
gttctcattgaggctgcgaagagcgggaatgagaaggaggtgaaggaatacgcccaagtt
ttccgtgaacatgccaacaagctggtggaggttgccaatttggcttgttccatctccaac
aatgaggaaggggtgaaattagtcagaatggcagccacccagattgacagcctgtgtccc
caagtcattaatgctgccctcacactggctgctcggccacagagtaaagttgctcaggac
aacatggatgtcttcaaagaccagtgggaaaagcaagtccgtgtgctcactgaggcagtg
gatgacatcacctctgtggatgacttcctctctgtctcagaaaaccatatcttggaggat
gtgaacaaatgtgtgattgccctgcaagagggagatgtggacacactggatcgcacagct
ggggccatacggggccgggcagcccgggtcattcacatcatcaatgcagagatggagaac
tatgaagctggggtctatacagagaaagtgctggaagccacaaaattgctttcagaaaca
gtgatgccacgctttgctgaacaagttgaggtggccatcgaagccctgagcgccaatgtc
cctcagccattcgaggagaacgagttcatcgatgcctcgcgcctggtgtatgacggtgtt
cgggacatcagaaaggctgtgctgatgatcaggactccagaagagctagaagatgattcc
gactttgagcaagaggattatgatgtgcggagtcggacaagtgttcagacagaggacgac
cagctcattgctggacagagtgcacgggccatcatggcgcaactaccacaggaggagaaa
gcaaaaatagctgaacaggtggagattttccaccaagaaaaaagcaagctggatgctgaa
gtggccaagtgggatgacagcggcaatgacatcattgtgctggccaagcagatgtgtatg
atcatgatggagatgacagacttcacaagaggcaaaggcccactgaaaaatacatctgat
gtcattaatgctgccaagaagattgcagaagcaggctctcgaatggacaaattagcgcgc
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcag
cggattgctttgtactgccatcagcttaacatctgcagcaaagtgaaggccgaggttcag
aacctaggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccaatcgggagtggaagcagtgactcctccatgctggac
agtgctacatcactcatccaggcagccaaaaacctgatgaatgctgttgtcctcacggtg
aaagcgtcttatgtagcctcaactaaataccagaaggtctatggaacagcagctgtcaac
tctccagttgtgtcttggaagatgaaggctcctgaaaagaagccccttgtgaagagagaa
aagcctgaagaattccagacaagagttagacgggggtctcaaaagaaacacatttcacct
gtgcaggctttaagtgaattcaaggcaatggattccttctag

KEGG   Mus musculus (mouse): 216033Help
Entry
216033            CDS       T01002                                 

Gene name
Ctnna3, 4930429L08Rik, 4933408A16, Catna3, Vr22
Definition
(RefSeq) catenin (cadherin associated protein), alpha 3
  KO
K05691  catenin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04670  Leukocyte transendothelial migration
mmu05100  Bacterial invasion of epithelial cells
mmu05200  Pathways in cancer
mmu05213  Endometrial cancer
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    216033 (Ctnna3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    216033 (Ctnna3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    216033 (Ctnna3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    216033 (Ctnna3)
  09162 Cancer: specific types
   05226 Gastric cancer
    216033 (Ctnna3)
   05213 Endometrial cancer
    216033 (Ctnna3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    216033 (Ctnna3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    216033 (Ctnna3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    216033 (Ctnna3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     216033 (Ctnna3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vinculin TMEM89
Motif
Other DBs
NCBI-GeneID: 216033
NCBI-ProteinID: NP_001157848
MGI: 2661445
Ensembl: ENSMUSG00000060843
Vega: OTTMUSG00000023790
UniProt: Q65CL1
LinkDB All DBs
Position
10; 10 B4-B5.1
AA seq 895 aa AA seqDB search
MSAETPITLNMDTQDLQIQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRARVLLA
SVEEATWNLLDKGEMIAKEATVLKEELAAALQEVRKESKALKVSAERFTDDPCYLPKREA
VVQAARALLAAVTRLLVLADMIDVMCLLQHVSSFQRTFESLKNVSNKSDLQRTYQKLGKE
LESLDYLAFKRQQDLKSPSQRDEIAGARATLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALDVISNASQGIQNAPAPPEPQAATLGSAFDELENLIVLNPLTVTEEDVRPSL
EKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLTEYMSNTGKTERSNTLN
TAIVNMSKKTRDLRRQLRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDYAAIFHE
HTGRLVEVANLACSMSTNEDGIKIVRIAANHLETLCPQIINAALALASRPKSQVVKNTME
MYKRTWEHYIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVAGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALDALSKNSLTA
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEDDHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPPCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIVSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSSAG
PRHPVVMWRMKAPAKKPLIKREKPEETWAAVRRGSAKKKIHPVQVMSEFRGRQVY
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagaaacgccaataaccctgaatatggacactcaggatctgcagatccaaacg
ttcactgtggagaaactgctggagcctctgataatccaggttactaccctggtgaattgt
ccgcagaatccttccaacaggaagaaaggacgttcaaagagagccagagttcttctagct
tccgtggaggaagcaacttggaatttgttagacaagggggagatgattgctaaggaagcc
acggttttaaaggaagagctggcagctgcactccaggaagttcgaaaagagagcaaagct
ctgaaggtatcagctgagagatttacagacgacccctgttacctcccgaaaagggaggcc
gtggttcaagccgcccgcgccctgttggcagcagttacaagactccttgttcttgccgac
atgattgatgtcatgtgcctcttgcagcatgtgtcatctttccaaagaacattcgagtct
ctcaaaaatgtttccaacaagtccgacctccagagaacctaccagaagctcgggaaggag
ctggaaagcctggattatttggccttcaaacgccagcaggacctaaaatctccaagccag
agggatgaaattgcaggggcccgggccaccttgaaggagaactccccactcctgcattct
atttgttcagcatgcttggaacattccgatgttgcttcgctcaaagccagtaaggacacc
gtctgtgaagagatccagaacgctcttgatgtaatttcaaatgcttcccaaggcatccag
aatgcgccagcgccccctgaacctcaggcagcaacactgggaagtgcttttgatgagctg
gagaacttaattgtcctgaacccactcacagtgacagaggaagatgtaagaccatcacta
gagaaacgcctagaagccatcatcagtggggccgcactgttggccgactcgtcctgcacc
agggacctccaccgggagcggattatcgccgagtgcaatgccatccgccaggctctccag
gacctgctgacggagtacatgagtaatactggaaaaacagaaaggagtaataccctgaat
actgccattgtcaacatgagcaagaagacaagagacctccgcagacagctccgcaaagct
atcatagatcacatatcagattctttcttggatacaacagttccactcctggtcctcatt
gaagctgcgaagaatggccgagtcaaggaaatcaaagactatgctgccatatttcatgag
cacactggcaggctcgtggaggtggcaaatctggcttgttccatgtcaacgaatgaagat
gggattaaaatcgtcagaattgcagccaatcacctggagaccctgtgtccacagatcata
aatgctgcacttgctttggcatcaagacccaagagtcaagtggtcaaaaacaccatggaa
atgtacaagcgcacatgggaacactacatccacgtcctcactgaagctgtagatgacatc
accagcattgacgactttctggctgtatctgaaagccacatcctggaagatgtcaacaaa
tgcattatagccttgagagatcaggatgctgataatttagaccgagctgccggtgccatc
agaggacgggccgcaagagtagctcacatcgttgcgggtgaaatggatagttacgaaccc
ggcgcttacaccgaaggtgtgatgagaaatgtcaacttccttacaagcactgtgatcccg
gagttcgtgacacaagtgaatgtggccctagatgctttaagcaagaactctctgactgcg
cttgatgataatcagtttgtggacatctccaagaagatctatgacacaatccatgatatc
aggtgttcggtcatgatgattcggacaccagaggaactagaggatgtttctgaccttgaa
gatgaccatgaggtccgtagccacaccagcattcagacagaagggaaaactgatcgggcc
aagatgactcaactgcctgaggcagaaaaggaaaagattgctgagcaagtcgccgacttc
aagaaggtgaagagcaagctggacgctgagattgagatatgggatgacacaagcaatgac
atcattgttcttgccaagaagatgtgcatgatcatgatggagatgaccgacttcacgagg
gggaaaggaccactaaagcataccactgatgtaatctatgcagctaaaatgatatcagag
tcaggatcaaggatggatgttcttgctcggcagattgctaaccagtgtccagatccaccg
tgcaaacaggacttgctggcttacctggaacagattaaattctactcccaccagctgaaa
atctgcagtcaagttaaagcagagatccaaaatctggggggagaactcatcgtatcagct
ttggacagtgtcacctccctgatccaggcagccaagaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcatacattgcctccaccaagatcatccgcatccagagttctgcagga
ccccggcacccagtagtcatgtggaggatgaaggctccggctaagaagcccttgattaaa
agagagaagccagaagaaacatgggcagctgtcagaagaggctctgccaagaaaaagatc
cacccagttcaagtcatgagtgaattcagagggagacaagtctactga

DBGET integrated database retrieval system