KEGG   Mus musculus (mouse): 12387Help
Entry
12387             CDS       T01002                                 

Gene name
Ctnnb1, Bfc, Catnb, Mesc
Definition
(RefSeq) catenin (cadherin associated protein), beta 1
  KO
K02105  catenin beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04670  Leukocyte transendothelial migration
mmu04916  Melanogenesis
mmu04919  Thyroid hormone signaling pathway
mmu04934  Cushing syndrome
mmu05100  Bacterial invasion of epithelial cells
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    12387 (Ctnnb1)
   04310 Wnt signaling pathway
    12387 (Ctnnb1)
   04390 Hippo signaling pathway
    12387 (Ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12387 (Ctnnb1)
   04520 Adherens junction
    12387 (Ctnnb1)
   04550 Signaling pathways regulating pluripotency of stem cells
    12387 (Ctnnb1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12387 (Ctnnb1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    12387 (Ctnnb1)
   04916 Melanogenesis
    12387 (Ctnnb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12387 (Ctnnb1)
   05205 Proteoglycans in cancer
    12387 (Ctnnb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    12387 (Ctnnb1)
   05225 Hepatocellular carcinoma
    12387 (Ctnnb1)
   05226 Gastric cancer
    12387 (Ctnnb1)
   05216 Thyroid cancer
    12387 (Ctnnb1)
   05217 Basal cell carcinoma
    12387 (Ctnnb1)
   05215 Prostate cancer
    12387 (Ctnnb1)
   05213 Endometrial cancer
    12387 (Ctnnb1)
   05224 Breast cancer
    12387 (Ctnnb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12387 (Ctnnb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    12387 (Ctnnb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12387 (Ctnnb1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12387 (Ctnnb1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    12387 (Ctnnb1)
   05163 Human cytomegalovirus infection
    12387 (Ctnnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12387 (Ctnnb1)
   05165 Human papillomavirus infection
    12387 (Ctnnb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 12387
NCBI-ProteinID: NP_001159374
MGI: 88276
Ensembl: ENSMUSG00000006932
Vega: OTTMUSG00000016490
UniProt: Q02248
LinkDB All DBs
Structure
PDB: 

Position
9 F4; 9 72.19 cM
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaagctgacctgatggagttggacatggccatggagccggacagaaaagct
gctgtcagccactggcagcagcagtcttacttggattctggaatccattctggtgccacc
accacagctccttccctgagtggcaagggcaaccctgaggaagaagatgttgacacctcc
caagtcctttatgaatgggagcaaggcttttcccagtccttcacgcaagagcaagtagct
gatattgacgggcagtatgcaatgactagggctcagagggtccgagctgccatgttccct
gagacgctagatgagggcatgcagatcccatccacgcagtttgacgctgctcatcccact
aatgtccagcgcttggctgaaccatcacagatgttgaaacatgcagttgtcaatttgatt
aactatcaggatgacgcggaacttgccacacgtgcaattcctgagctgacaaaactgcta
aacgatgaggaccaggtggtagttaataaagctgctgttatggtccatcagctttccaaa
aaggaagcttccagacatgccatcatgcgctcccctcagatggtgtctgccattgtacgc
accatgcagaatacaaatgatgtagagacagctcgttgtactgctgggactctgcacaac
ctttctcaccaccgcgagggcttgctggccatctttaagtctggtggcatcccagcgctg
gtgaaaatgcttgggtcaccagtggattctgtactgttctacgccatcacgacactgcat
aatctcctgctccatcaggaaggagctaaaatggcagtgcgcctagctggtggactgcag
aaaatggttgctttgctcaacaaaacaaacgtgaaattcttggctattacaacagactgc
cttcagatcttagcttatggcaatcaagagagcaagctcatcattctggccagtggtgga
ccccaagccttagtaaacataatgaggacctacacttatgagaagcttctgtggaccaca
agcagagtgctgaaggtgctgtctgtctgctctagcaacaagccggccattgtagaagct
ggtgggatgcaggcactggggcttcatctgacagacccaagtcagcgacttgttcaaaac
tgtctttggactctcagaaacctttcagatgcagcgactaagcaggaagggatggaaggc
ctccttgggactctagtgcagcttctgggttccgatgatataaatgtggtcacctgtgca
gctggaattctctctaacctcacttgcaataattacaaaaacaagatgatggtgtgccaa
gtgggtggcatagaggctcttgtacgcaccgtccttcgtgctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatctgaccagccggcatcaggaagccgagatg
gcccagaatgccgttcgccttcattatggactgcctgttgtggttaaactcctgcaccca
ccatcccactggcctctgataaaggcaactgttggattgattcgaaaccttgccctttgc
ccagcaaatcatgcgcctttgcgggaacagggtgctattccacgactagttcagctgctt
gtacgagcacatcaggacacccaacggcgcacctccatgggtggaacgcagcagcagttt
gtggagggcgtgcgcatggaggagatagtagaagggtgtactggagctctccacatcctt
gctcgggacgttcacaaccggattgtaatccgaggactcaataccattccattgtttgtg
cagttgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaggccattgaagctgagggagccacagctcccctg
acagagttactccactccaggaatgaaggcgtggcaacatacgcagctgctgtcctattc
cgaatgtctgaggacaagccacaggattacaagaagcggctttcagtcgagctgaccagt
tccctcttcaggacagagccaatggcttggaatgagactgcagatcttggactggacatt
ggtgcccagggagaagcccttggatatcgccaggatgatcccagctaccgttcttttcac
tctggtggatacggccaggatgccttggggatggaccctatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgcctgatctgggacacgcccag
gacctcatggatgggctgcccccaggtgatagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system