KEGG   Mus musculus (mouse): 12394Help
Entry
12394             CDS       T01002                                 

Gene name
Runx1, AML1, CBF-alpha-2, Cbfa2, Pebp2a2, Pebpa2b
Definition
(RefSeq) runt related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12394 (Runx1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    12394 (Runx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12394 (Runx1)
   05202 Transcriptional misregulation in cancer
    12394 (Runx1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12394 (Runx1)
   05220 Chronic myeloid leukemia
    12394 (Runx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12394 (Runx1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Runt
    12394 (Runx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Runt RunxI DUF3037
Motif
Other DBs
NCBI-GeneID: 12394
NCBI-ProteinID: NP_001104491
MGI: 99852
Ensembl: ENSMUSG00000022952
Vega: OTTMUSG00000049470
UniProt: Q3UM65
LinkDB All DBs
Structure
PDB: 

Position
16 C4; 16 53.7 cM
AA seq 465 aa AA seqDB search
MASDSIFESFPSYPQCFMRDASTSRRFTPPSTALSPGKMSEALPLGAPDGGAALASKLRS
GDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVM
AGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAI
KITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASL
NHSTAFNPQPQSQMQDARQIQPSPPWSYDQSYQYLGSITSSSVHPATPISPGRASGMTSL
SAELSSRLSTAPDLTAFGDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSSA
SRYHTYLPPPYPGSSQAQAGPFQTGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTN
ASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagacagcatttttgagtcatttccttcatatccacagtgcttcatgagagat
gccagcacgagccgccgcttcacgccgccttccaccgcgctgagccccggcaagatgagc
gaggcgctgccgctgggcgccccggatggcggcgccgccctggccagcaagctgaggagc
ggcgaccgcagcatggtggaggtactagctgaccaccctggcgagctagtgcgcaccgac
agccccaacttcctctgctccgtgctacccactcactggcgctgcaacaagaccctgccc
atcgctttcaaggtggtggcactgggggacgtcccggatggcactctggtcaccgtcatg
gcaggcaacgatgaaaactactcggcagaactgagaaatgctaccgcggccatgaagaac
caggtagcgagattcaacgacctcaggtttgtcgggcggagcggtagaggcaagagcttc
actctgaccatcaccgtctttacaaatccgccacaagttgccacctaccatagagccatc
aaaatcacagtggacggcccccgagaaccccgaagacatcggcagaaactagatgatcag
accaagcccgggagtttgtccttttccgagcggctcagtgaattggagcagctgcggcgc
acggccatgagggtcagcccgcaccacccagcccccacgcccaaccctcgggcctccttg
aaccactccactgcctttaaccctcagcctcaaagtcagatgcaggatgccaggcagatc
cagccatccccaccgtggtcctatgaccagtcctaccagtacctgggatccatcacctct
tcctctgtccacccagcgacacccatttcacccggccgtgccagcggcatgaccagcctc
tctgcagaactttccagtcgactctcaacggctccggacctgaccgccttcggcgaccca
cgccagttccctactctgccgtccatctccgacccgcgcatgcactacccaggcgccttc
acctactcgccgcccgtcacgtcgggcatcggcatcggcatgtcagccatgagctcggcc
tctcgctaccacacctacctgccgccgccctaccccggctcatcacaggcgcaggccggg
cccttccagaccggctcgccctcctaccatctatactacggcgcctcggccggttcctac
cagttctccatggtgggcggagagagatcgcccccgcgcatcctgccgccctgcaccaac
gcatccaccggcgccgcgctgctcaaccccagcctccccagccagagcgacgtggtggag
accgagggcagccatagcaactcgcccaccaacatgccccccgcgcgcctggaggaggcc
gtgtggcggccctactga

KEGG   Mus musculus (mouse): 12395Help
Entry
12395             CDS       T01002                                 

Gene name
Runx1t1, Cbfa2t1h, ETO, MTG8
Definition
(RefSeq) RUNX1 translocation partner 1
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12395 (Runx1t1)
   05202 Transcriptional misregulation in cancer
    12395 (Runx1t1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12395 (Runx1t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NHR2 TAFH zf-MYND Efg1 DUF3731 DUF4434
Motif
Other DBs
NCBI-GeneID: 12395
NCBI-ProteinID: NP_033952
MGI: 104793
Ensembl: ENSMUSG00000006586
Vega: OTTMUSG00000004483
UniProt: Q61909 B1AXH9 Q8C066
LinkDB All DBs
Position
4 A1; 4 5.88 cM
AA seq 577 aa AA seqDB search
MPDRTEKHSTMPDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTAL
NGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGER
VRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNP
AQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRP
CTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRN
RPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE
ELNYWIRRYSDAEDLKKGGSSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWK
KAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQ
QEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAPQQGDTPAVS
SSVTPSSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcgtaccgagaagcactccacaatgccagactcacctgtggatgtgaagacg
cagtctaggctgactcccccagcaatgccacctcctccaaccactcaaggagctccaaga
accagctcatttacgccaacgacattaacgaatggcaccagccattcacccacggccttg
aatggcgctccctcaccgcctaatggctttagcaacgggccttcttcttcctcttcctct
tctctggctaatcagcagctgcccccagcctgtggtgctaggcaactcagcaagctgaaa
cgatttcttactaccctgcagcagtttggcaatgacatttcaccagagattggagaaaga
gttcgcacccttgtactgggactggtgaactctactttgacaattgaagaatttcattcc
aaactgcaagaagctactaacttcccactgagaccttttgtcatcccgtttttgaaggcc
aacctgcccctgctccagcgtgaactcctccactgcgcaaggctagccaaacagaaccct
gcccagtacctcgctcagcacgaacagctgcttctggatgccagcaccacctcccctgtc
gactcctcagagctgcttctcgacgtgaacgaaaacgggaagaggcgaactccagacaga
accaaagaaaatggctttgacagagagcctttgcactcagaacatccaagcaagcgacca
tgcactattagcccaggccagcggtacagtccaaataatggcttatcctaccagccaaat
ggcctgcctcaccccaccccacctccacctcagcattaccgattggatgatatggccatt
gcccaccactacagggactcctatcgacaccccagccacagggacctcagggacagaaat
agacctatggggttacatggcacacgtcaagaagaaatgattgaccacagactaacagac
agagaatgggcagaagagtggaaacatctcgatcatctgttaaactgcatcatggacatg
gtggagaagacaagacgatccctcactgtactaagacgatgtcaggaagcggaccgggaa
gaactgaattactggatacggcggtacagtgatgctgaggacttaaaaaagggtggcagc
agtagcagcagccactccaggcagcagagtcctgtcaatccagacccagtcgcattagat
gcacatcgggaattccttcacaggcctgcgtctggatacgtgccagaggagatctggaag
aaagctgaggaagctgtgaatgaggtgaagcgacaggcaatgacggagctgcaaaaagcc
gtgtctgaggcagagaggaaagcccatgacatgatcaccacggagcgagccaagatggaa
cgcacggtggctgaagcgaagaggcaggcagcagaagatgctctagcagtcatcaaccag
caggaagactccagtgagagttgctggaactgtggccggaaagcaagtgagacgtgcagc
ggctgtaacacggcccgatactgtggctctttttgccagcataaagactgggagaagcat
caccacatctgtggacagaccctgcaggccccacagcagggagacacgcccgctgtcagc
tcctcagtcacacccagcagtggggctgggagcccaatggacacaccaccagcagccact
ccgaggtctaccaccccgggaaccccctctaccatagagacgacgcctcgctag

DBGET integrated database retrieval system