KEGG   Mus musculus (mouse): 12447Help
Entry
12447             CDS       T01002                                 

Gene name
Ccne1, AW538188, CycE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05161  Hepatitis B
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12447 (Ccne1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12447 (Ccne1)
   04114 Oocyte meiosis
    12447 (Ccne1)
   04115 p53 signaling pathway
    12447 (Ccne1)
   04218 Cellular senescence
    12447 (Ccne1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12447 (Ccne1)
   05206 MicroRNAs in cancer
    12447 (Ccne1)
   05203 Viral carcinogenesis
    12447 (Ccne1)
  09162 Cancer: specific types
   05226 Gastric cancer
    12447 (Ccne1)
   05215 Prostate cancer
    12447 (Ccne1)
   05222 Small cell lung cancer
    12447 (Ccne1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12447 (Ccne1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12447 (Ccne1)
   05162 Measles
    12447 (Ccne1)
   05161 Hepatitis B
    12447 (Ccne1)
   05169 Epstein-Barr virus infection
    12447 (Ccne1)
   05165 Human papillomavirus infection
    12447 (Ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12447 (Ccne1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12447 (Ccne1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12447 (Ccne1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12447 (Ccne1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 12447
NCBI-ProteinID: NP_031659
MGI: 88316
Ensembl: ENSMUSG00000002068
Vega: OTTMUSG00000022262
UniProt: Q61457
LinkDB All DBs
Position
7 B3; 7 25.35 cM
AA seq 408 aa AA seqDB search
MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWD
DNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLN
KEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHN
IIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLS
PLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAAS
ALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQT
HTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccaagggagagagactcgacggaccacagcaacatgaaagaagaaggtggctccgac
ctttcagtccgctccagaaaaaggaaggcaaatgtggccgtgtttttgcaagacccagat
gaagaaattgccaagattgacaagactgtgaaaagcgaggatagcagtcagccctgggat
gataattcagcatgcgtggacccctgctctttcatccccacccctaacaaagaagaggac
aatgagcttgaataccccaggactgcatttcagcctcggaaaatcagaccacccagagcc
tccccacttcccgtcttgaattggggcaatagagaagaggtttggaggatcatgttaaac
aaagaaaagacttacctgagagatgagcactttctgcagcgtcatcctctcctgcaggcg
aggatgagagcagttcttctggattggctaatggaggtgtgcgaagtctataagctccac
agagagacgttctacttggcacaggacttctttgatcgttacatggcatcacaacataat
atcataaaaacacttttacagcttattgggatttcagccttatttattgcttcaaaactt
gaggaaatctaccctccaaagttgcaccagtttgcttatgttacagatggcgcttgctcc
ggggatgaaattcttaccatggaattgatgatgatgaaggcccttaagtggcgtctaagc
cctctgaccattgtgtcctggctgaatgtctatgtccaagtggcctatgtcaacgacacg
ggtgaggtgctgatgcctcagtacccacagcaggtcttcgtgcagatcgcagagcttcta
gacctgtgcgtcctggatgttggctgcttagaatttccttatggtgtcctcgctgcttct
gctttgtatcatttctcctcactggagttgatgcagaaggtctcaggttatcagtggtgc
gacatagagaagtgtgtcaaatggatggttccgttcgccatggttatccgggagatggga
agttccaagctcaagcacttccggggagtccccatggaagactcccacaacatccagacc
cacaccaacagcttggatttgctggacaaagcccaagcaaagaaagccatattgtcagaa
cagaataggatttctcctcctccgagtgtggtcctgacacccccacccagcagtaagaag
cagagcagcgagcaggagacagaatga

KEGG   Mus musculus (mouse): 12448Help
Entry
12448             CDS       T01002                                 

Gene name
Ccne2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05161  Hepatitis B
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12448 (Ccne2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12448 (Ccne2)
   04114 Oocyte meiosis
    12448 (Ccne2)
   04115 p53 signaling pathway
    12448 (Ccne2)
   04218 Cellular senescence
    12448 (Ccne2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12448 (Ccne2)
   05206 MicroRNAs in cancer
    12448 (Ccne2)
   05203 Viral carcinogenesis
    12448 (Ccne2)
  09162 Cancer: specific types
   05226 Gastric cancer
    12448 (Ccne2)
   05215 Prostate cancer
    12448 (Ccne2)
   05222 Small cell lung cancer
    12448 (Ccne2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12448 (Ccne2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12448 (Ccne2)
   05162 Measles
    12448 (Ccne2)
   05161 Hepatitis B
    12448 (Ccne2)
   05169 Epstein-Barr virus infection
    12448 (Ccne2)
   05165 Human papillomavirus infection
    12448 (Ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12448 (Ccne2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12448 (Ccne2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12448 (Ccne2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12448 (Ccne2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 12448
NCBI-ProteinID: NP_001032211
MGI: 1329034
Ensembl: ENSMUSG00000028212
Vega: OTTMUSG00000004537
UniProt: Q9Z238 Q544H6
LinkDB All DBs
Position
4; 4 A1
AA seq 404 aa AA seqDB search
MSRRSSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEEITKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQK
ENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDV
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCP
VTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTH
TNYLALLNEVNYVNIYRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacatgcccagcccaaccagccagac
tctccgcaagaaacccagataattcaggccaagaagagaaaaacagcacaggatgtcaaa
aaaagaaaagaggagatcaccaagaagcatcagtatgagattaggaattgttggccacct
gtactgtctggaggaatcagcccttgcattatcattgaaacaccccataaagaaatagga
acaagtgacttctctagatttacaaattacagatttaaaaatctttttattaatccctca
cctctgccagatttaagctgggcatgttcacaggaggtttggcaaaacatgttacaaaag
gaaaacagatacgtgcatgacaaacattttcaagttctgcattctgacctggaaccacag
atgaggtcaatacttttagactggcttttagaggtttgtgaagtatacactcttcatagg
gagacattttaccttgcccaagacttttttgacagatttatgttgacacaaaaggatgta
aataaaaatatgcttcaactcattgggattacctcattgttcattgcttccaaacttgag
gaaatctacgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gtagatatcttaaagatggaactcaatatattaaaggctttaaaatgggaactttgtcca
gtaacagtcatctcctggttgaatctttttcttcaagttgatgctgttaaagatgttcct
aaggttcttctacctcaatattctcaggagacgttcatccagatagctcagcttttagat
ctgtgcattctagccatcgactctttagaatttcaatacagaattctggctgctgccgcc
ttatgtcattttacctccattgaagtggttaagaaagcttcaggtttggaatgggatgac
atctcggaatgtgtagactggatggtgccttttgttagtgttgtaaaaagtgtgagtcca
gtgaagctgaagacttttaagaagatacccatggaagatagacacaatatccagacacac
acaaattatttggctttgctgaatgaagtaaactatgtgaacatctacagaaaaggaggg
cagctgtcaccagtgtgtaatggaggcattatgacaccaccaaagagtactgaaaaacca
ccaggaaaacactga

DBGET integrated database retrieval system