KEGG   Mus musculus (mouse): 12475Help
Entry
12475             CDS       T01002                                 

Gene name
Cd14
Definition
(RefSeq) CD14 antigen
  KO
K04391  monocyte differentiation antigen CD14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04145  Phagosome
mmu04620  Toll-like receptor signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12475 (Cd14)
   04064 NF-kappa B signaling pathway
    12475 (Cd14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    12475 (Cd14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12475 (Cd14)
   04620 Toll-like receptor signaling pathway
    12475 (Cd14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12475 (Cd14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12475 (Cd14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    12475 (Cd14)
   05133 Pertussis
    12475 (Cd14)
   05134 Legionellosis
    12475 (Cd14)
   05152 Tuberculosis
    12475 (Cd14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12475 (Cd14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12475 (Cd14)
   04090 CD molecules [BR:mmu04090]
    12475 (Cd14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    12475 (Cd14)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   12475 (Cd14)
CD molecules [BR:mmu04090]
 Proteins
  12475 (Cd14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  12475 (Cd14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 12475
NCBI-ProteinID: NP_033971
MGI: 88318
Ensembl: ENSMUSG00000051439
UniProt: P10810 Q4FJP7 Q3UE54 Q3UB18
LinkDB All DBs
Structure
PDB: 

Position
18 B2; 18 19.46 cM
AA seq 366 aa AA seqDB search
MERVLGLLLLLLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGR
SLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLE
NLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLN
FSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSAL
AAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSY
NRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLL
GDRLFV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtgtgcttggcttgttgctgttgcttctggtgcacgcctctcccgccccacca
gagccctgcgagctagacgaggaaagttgttcctgcaacttctcagatccgaagccagat
tggtccagcgctttcaattgtttgggggcggcagatgtggaattgtacggcggcggccgc
agcctggaataccttctaaagcgtgtggacacggaagcagatctggggcagttcactgat
attatcaagtctctgtccttaaagcggcttacggtgcgggccgcgcggattcctagtcgg
attctattcggagccctgcgtgtgctcgggatttccggcctccaggaactgactcttgaa
aatctcgaggtaaccggcaccgcgccgccaccgcttctggaagccaccggacccgatctc
aacatcttgaacctccgcaacgtgtcgtgggcaacaagggatgcctggctcgcagaactg
cagcagtggctaaagcctggactcaaggtactgagtattgcccaagcacactcgctcaac
ttttcctgcgaacaggtccgcgtcttccctgccctctccaccttagacctgtctgacaat
cctgaattgggcgagagaggactgatctcagccctctgtcccctcaagttcccgaccctc
caagttttagcgctgcgtaacgcggggatggagacgcccagcggcgtgtgctctgcgctg
gccgcagcaagggtacagctgcaaggactagaccttagtcacaattcactgcgggatgct
gcaggcgctccgagttgtgactggcccagtcagctaaactcgctcaatctgtctttcact
gggctgaagcaggtacctaaagggctgccagccaagctcagcgtgctggatctcagttac
aacaggctggataggaaccctagcccagatgagctgccccaagtggggaacctgtcactt
aaaggaaatccctttttggactctgaatcccactcggagaagtttaactctggcgtagtc
accgccggagctccatcatcccaagcagtggccttgtcaggaactctggctttgctccta
ggagatcgcctctttgtttaa

DBGET integrated database retrieval system