KEGG   Mus musculus (mouse): 12550Help
Entry
12550             CDS       T01002                                 

Gene name
Cdh1, AA960649, ARC-1, E-cad, Ecad, L-CAM, UVO, Um
Definition
(RefSeq) cadherin 1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04371  Apelin signaling pathway
mmu04390  Hippo signaling pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04520  Adherens junction
mmu05100  Bacterial invasion of epithelial cells
mmu05200  Pathways in cancer
mmu05213  Endometrial cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    12550 (Cdh1)
   04390 Hippo signaling pathway
    12550 (Cdh1)
   04371 Apelin signaling pathway
    12550 (Cdh1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12550 (Cdh1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    12550 (Cdh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12550 (Cdh1)
  09162 Cancer: specific types
   05226 Gastric cancer
    12550 (Cdh1)
   05216 Thyroid cancer
    12550 (Cdh1)
   05218 Melanoma
    12550 (Cdh1)
   05219 Bladder cancer
    12550 (Cdh1)
   05213 Endometrial cancer
    12550 (Cdh1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12550 (Cdh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12550 (Cdh1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    12550 (Cdh1)
   04090 CD molecules [BR:mmu04090]
    12550 (Cdh1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12550 (Cdh1)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   12550 (Cdh1)
CD molecules [BR:mmu04090]
 Proteins
  12550 (Cdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 Cadherin_3
Motif
Other DBs
NCBI-GeneID: 12550
NCBI-ProteinID: NP_033994
MGI: 88354
Ensembl: ENSMUSG00000000303
Vega: OTTMUSG00000020588
UniProt: P09803 A0A0R4IZW5
LinkDB All DBs
Structure
PDB: 

Position
8 D3; 8 53.18 cM
AA seq 884 aa AA seqDB search
MGARCRSFSALLLLLQVSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRVRFE
GCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKS
MGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQI
KSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSN
GEAVEDPMEIVITVTDQNDNRPEFTQPVFEGFVAEGAVPGTSVMKVSATDADDDVNTYNA
AIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTT
AKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVND
PDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVV
DVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKITYRIWRDTANWLEINPE
TGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPR
NMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDL
EIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGIL
ALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDA
RPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGS
GSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccggtgccgcagcttttccgcgctcctgctcctgctgcaggtctcctcatgg
ctttgccaggagctggagcctgagtcctgcagtcccggcttcagttccgaggtctacacc
ttcccggtgccggagaggcacctggagagaggccatgtcctgggcagagtgagatttgaa
ggatgcactggccggccaaggacagccttcttttcggaagactcccgattcaaagtggcg
acagacggcaccatcacagtgaagcggcatctaaagctccacaagctggagaccagtttc
ctcgtccgcgcccgggactccagtcatagggagctgtctaccaaagtgacgctgaagtcc
atggggcaccaccatcaccggcaccaccaccgcgaccctgcctctgaatccaacccagag
ctgctcatgtttcccagcgtgtacccaggtctcagaagacagaaacgagactgggtcatc
cctcccatcagctgccccgaaaatgaaaagggcgaatttccaaagaacctggttcagatc
aaatccaacagggacaaagaaacaaaggttttctacagcatcaccggccaaggagctgac
aaaccccccgttggcgttttcatcattgagagggagacaggctggctgaaagtgacacag
cctctggatagagaagccattgccaagtacatcctctattctcatgccgtgtcatcaaat
ggggaagcggtggaggatcccatggagatagtgatcacagtgacagatcagaatgacaac
aggccagagtttacccagccggtctttgagggattcgttgcagaaggcgctgttccagga
acctccgtgatgaaggtctcagccaccgatgcagacgatgacgtcaacacctacaacgct
gccatcgcctacaccatcgtcagccaggatcctgagctgcctcacaaaaacatgttcact
gtcaatagggacaccggggtcatcagtgtgctcacctctgggctggaccgagagagttac
cctacatacactctggtggttcaggctgctgaccttcaaggtgaaggcttgagcacaaca
gccaaggctgtgatcactgtcaaggatattaatgacaacgctcctgtcttcaacccaagc
acgtatcagggtcaagtgcctgagaatgaggtcaatgcccggatcgccacactcaaagtg
accgatgatgatgcccccaacactccggcgtggaaagctgtgtacaccgtagtcaacgat
cctgaccagcagttcgttgttgtcacagaccccacgaccaatgatggcattttgaaaaca
gccaagggcttggattttgaggccaagcagcaatacatccttcatgtgagagtggagaac
gaggaaccctttgaggggtctcttgtcccttccacagccactgtcactgtggacgtggta
gacgtgaatgaagcccccatctttatgcctgcggagaggagagtcgaagtgcccgaagac
tttggtgtgggtcaggaaatcacatcttataccgctcgagagccggacacgttcatggat
cagaagatcacgtatcggatttggagggacactgccaactggctggagattaacccagag
actggtgccattttcacgcgcgctgagatggacagagaagacgctgagcatgtgaagaac
agcacatatgtagctctcatcatcgccacagatgatggttcacccattgccactggcacg
ggcactcttctcctggtcctgttagacgtcaatgacaacgctcccatcccagaacctcga
aacatgcagttctgccagaggaacccacagcctcatatcatcaccatcttggatccagac
cttccccccaacacgtccccctttactgctgagctaacccatggggccagcgtcaactgg
accattgagtataatgacgcagctcaagaatctctcattttgcaaccaagaaaggactta
gagattggcgaatacaaaatccatctcaagctcgcggataaccagaacaaagaccaggtg
accacgttggacgtccatgtgtgtgactgtgaagggacggtcaacaactgcatgaaggcg
ggaatcgtggcagcaggattgcaagttcctgccatcctcggaatccttggagggatcctc
gccctgctgattctgatcctgctgctcctactgtttctacggaggagaacggtggtcaaa
gagcccctgctgccaccagatgatgatacccgggacaatgtgtattactatgatgaagaa
ggaggtggagaagaagaccaggactttgatttgagccagctgcacaggggcctggatgcc
cgaccggaagtgactcgaaatgatgtggctcccaccctcatgagcgtgccccagtatcgt
ccccgtcctgccaatcctgatgaaattggaaacttcatcgatgaaaacctgaaggcagcc
gacagcgaccccacggcacccccttacgactctctgttggtgttcgattacgagggcagt
ggttctgaagccgctagcctgagctcactgaactcctctgagtcggatcaggaccaggac
tacgattatctgaacgagtggggcaaccgattcaagaagctggcggacatgtacggcggt
ggtgaggacgactag

DBGET integrated database retrieval system