KEGG   Mus musculus (mouse): 12566Help
Entry
12566             CDS       T01002                                 

Gene name
Cdk2, A630093N05Rik
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04914  Progesterone-mediated oocyte maturation
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12566 (Cdk2)
   04151 PI3K-Akt signaling pathway
    12566 (Cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12566 (Cdk2)
   04114 Oocyte meiosis
    12566 (Cdk2)
   04115 p53 signaling pathway
    12566 (Cdk2)
   04218 Cellular senescence
    12566 (Cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12566 (Cdk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12566 (Cdk2)
   05203 Viral carcinogenesis
    12566 (Cdk2)
  09162 Cancer: specific types
   05226 Gastric cancer
    12566 (Cdk2)
   05215 Prostate cancer
    12566 (Cdk2)
   05222 Small cell lung cancer
    12566 (Cdk2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12566 (Cdk2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12566 (Cdk2)
   05162 Measles
    12566 (Cdk2)
   05161 Hepatitis B
    12566 (Cdk2)
   05160 Hepatitis C
    12566 (Cdk2)
   05169 Epstein-Barr virus infection
    12566 (Cdk2)
   05165 Human papillomavirus infection
    12566 (Cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12566 (Cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12566 (Cdk2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12566 (Cdk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12566 (Cdk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12566 (Cdk2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12566 (Cdk2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    12566 (Cdk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 12566
NCBI-ProteinID: NP_904326
MGI: 104772
Ensembl: ENSMUSG00000025358
UniProt: P97377 Q3UGB9 Q3U6X7
LinkDB All DBs
Position
10; 10 D3
AA seq 346 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
APHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggagaagattggagagggcacgtacggagtggtgtacaaa
gccaaaaacaagttgacgggagaagttgtggcgcttaagaagatccggctcgacactgag
actgaaggtgtacccagtactgccatccgagagatctctctccttaaggaacttaatcac
cctaatatcgtcaagctgctggatgtcatccacacagaaaataagctttatctggttttt
gaatttctgcaccaggacctcaagaaattcatggatgcctctgctctcacgggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctggctttctgccattct
caccgtgtccttcaccgagaccttaagccccagaacctgcttatcaatgcagaggggtcc
atcaagctggcagactttggactagcaagagcctttggagtccctgtccgaacttacact
catgaggtggtgaccctgtggtaccgagcacctgaaattcttctgggctgcaagtactac
tccacagccgtggatatctggagcctgggctgcatctttgctgaaatgcacctagtgtgt
acccagcaccatgctaagtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
gccccacaccccgtgacccgcagggccctattccctggagattctgagattgaccaactc
ttccggatctttcggactctggggaccccagatgaggtggtttggccaggagttacttct
atgcctgattataagccaagtttccccaagtgggctcggcaagattttagcaaagttgtg
cctcccctggatgaagatggacggagcttgttatcgcaaatgctgcactatgaccccaac
aagcggatttcagccaaagcagccctggctcaccctttcttccaggatgtaactaaacca
gtgccccaccttcggctctga

DBGET integrated database retrieval system