KEGG   Mus musculus (mouse): 12567Help
Entry
12567             CDS       T01002                                 

Gene name
Cdk4, Crk3
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04530  Tight junction
mmu04660  T cell receptor signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12567 (Cdk4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12567 (Cdk4)
   04115 p53 signaling pathway
    12567 (Cdk4)
   04218 Cellular senescence
    12567 (Cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12567 (Cdk4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    12567 (Cdk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12567 (Cdk4)
   05203 Viral carcinogenesis
    12567 (Cdk4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    12567 (Cdk4)
   05225 Hepatocellular carcinoma
    12567 (Cdk4)
   05214 Glioma
    12567 (Cdk4)
   05220 Chronic myeloid leukemia
    12567 (Cdk4)
   05218 Melanoma
    12567 (Cdk4)
   05219 Bladder cancer
    12567 (Cdk4)
   05224 Breast cancer
    12567 (Cdk4)
   05222 Small cell lung cancer
    12567 (Cdk4)
   05223 Non-small cell lung cancer
    12567 (Cdk4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12567 (Cdk4)
   04934 Cushing syndrome
    12567 (Cdk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12567 (Cdk4)
   05162 Measles
    12567 (Cdk4)
   05164 Influenza A
    12567 (Cdk4)
   05160 Hepatitis C
    12567 (Cdk4)
   05163 Human cytomegalovirus infection
    12567 (Cdk4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12567 (Cdk4)
   05169 Epstein-Barr virus infection
    12567 (Cdk4)
   05165 Human papillomavirus infection
    12567 (Cdk4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    12567 (Cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12567 (Cdk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12567 (Cdk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12567 (Cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 12567
NCBI-ProteinID: NP_034000
MGI: 88357
Ensembl: ENSMUSG00000006728
Vega: OTTMUSG00000030604
UniProt: P30285 Q545C3
LinkDB All DBs
Position
10; 10 D3
AA seq 303 aa AA seqDB search
MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES
DAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtggccctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta
aggaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggacctg
aggacatacctggacaaagcacctccaccgggcctgccggttgagaccattaaggatcta
atgcgtcagtttctaagcggcctggattttcttcatgcaaactgcattgttcaccgggac
ctgaagccagagaacattctagtgacaagtaatgggaccgtcaagctggctgactttggc
ctagctagaatctacagctaccagatggccctcacgcctgtggtggttacgctctggtac
cgagctcctgaagttcttctgcagtctacatacgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgttccgtcggaagcctctcttctgtggaaactctgaagcc
gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtatctctacctcgaggagcctttgcccccagagggcctcggccagtgcagtcagtg
gtgccagagatggaggagtctggagcgcagctgctactggaaatgctgacctttaaccca
cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc
gacgcagagtga

KEGG   Mus musculus (mouse): 12571Help
Entry
12571             CDS       T01002                                 

Gene name
Cdk6, AI504062, Crk2
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12571 (Cdk6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12571 (Cdk6)
   04115 p53 signaling pathway
    12571 (Cdk6)
   04218 Cellular senescence
    12571 (Cdk6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12571 (Cdk6)
   05206 MicroRNAs in cancer
    12571 (Cdk6)
   05203 Viral carcinogenesis
    12571 (Cdk6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    12571 (Cdk6)
   05225 Hepatocellular carcinoma
    12571 (Cdk6)
   05214 Glioma
    12571 (Cdk6)
   05220 Chronic myeloid leukemia
    12571 (Cdk6)
   05218 Melanoma
    12571 (Cdk6)
   05224 Breast cancer
    12571 (Cdk6)
   05222 Small cell lung cancer
    12571 (Cdk6)
   05223 Non-small cell lung cancer
    12571 (Cdk6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12571 (Cdk6)
  09172 Infectious disease: viral
   05162 Measles
    12571 (Cdk6)
   05164 Influenza A
    12571 (Cdk6)
   05160 Hepatitis C
    12571 (Cdk6)
   05163 Human cytomegalovirus infection
    12571 (Cdk6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12571 (Cdk6)
   05169 Epstein-Barr virus infection
    12571 (Cdk6)
   05165 Human papillomavirus infection
    12571 (Cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12571 (Cdk6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12571 (Cdk6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12571 (Cdk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo Kinase-like RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 12571
NCBI-ProteinID: NP_034003
MGI: 1277162
Ensembl: ENSMUSG00000040274
Vega: OTTMUSG00000052940
UniProt: Q64261 Q0VBK8
LinkDB All DBs
Position
5 A1; 5 2.04 cM
AA seq 326 aa AA seqDB search
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYF
QDLERYKDNLNSHLPSNQSTSELNTA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggacagcctgagtcgcgccgatcagcagtatgagtgcgtggcggagatcggc
gaaggcgcctatgggaaggtgttcaaggcccgcgacctgaagaacggcggccgcttcgtg
gctctgaagcgcgtgcgagtgcagaccagtgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacggacggacagagaaaccaagcttacactagtgtttgagcat
gttgatcaagacttgaccacttacttggataaagttccagagcccggcgtacccacagaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcacaga
gtagtgcatcgtgatctgaaaccgcagaacattctggtgaccagcagtggacagataaag
ctggctgactttggccttgcccgcatctatagttttcagatggcccttacctcggtggtc
gtcacgctgtggtaccgagccccagaagtcctgctccagtccagctatgccacccctgtg
gacctctggagtgtcggttgcatctttgcagaaatgtttcgcagaaagcctctttttcgt
ggaagttcagacgtggatcaactaggaaaaatcttggacatcattggactcccaggagag
gaagactggcctagggacgtggcccttccccggcaggcttttcattccaaatctgctcaa
cccatcgagaagtttgtgacagatattgacgaactaggcaaagacctacttctgaaatgc
ctgacgtttaatccagctaaaaggatatccgcctacggcgccctgaatcacccgtacttc
caagatctggagagatacaaggacaacctgaactctcacctgccatccaaccagagcacc
tcggagctgaacacagcctga

DBGET integrated database retrieval system