KEGG   Mus musculus (mouse): 12576Help
Entry
12576             CDS       T01002                                 

Gene name
Cdkn1b, AA408329, AI843786, Kip1, p27, p27Kip1
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04151  PI3K-Akt signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    12576 (Cdkn1b)
   04066 HIF-1 signaling pathway
    12576 (Cdkn1b)
   04068 FoxO signaling pathway
    12576 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    12576 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12576 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12576 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    12576 (Cdkn1b)
   05206 MicroRNAs in cancer
    12576 (Cdkn1b)
   05203 Viral carcinogenesis
    12576 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    12576 (Cdkn1b)
   05220 Chronic myeloid leukemia
    12576 (Cdkn1b)
   05215 Prostate cancer
    12576 (Cdkn1b)
   05222 Small cell lung cancer
    12576 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12576 (Cdkn1b)
   04934 Cushing syndrome
    12576 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    12576 (Cdkn1b)
   05169 Epstein-Barr virus infection
    12576 (Cdkn1b)
   05165 Human papillomavirus infection
    12576 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    12576 (Cdkn1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 12576
NCBI-ProteinID: NP_034005
MGI: 104565
Ensembl: ENSMUSG00000003031
Vega: OTTMUSG00000021172
UniProt: P46414
LinkDB All DBs
Position
6 G1; 6 65.77 cM
AA seq 197 aa AA seqDB search
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIG
SQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPN
AGTVEQTPKKPGLRRQT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgtgagagtgtctaacgggagcccgagcctggagcggatggacgccagacaa
gcggagcaccccaagccttccgcctgcagaaatctcttcggcccggtcaatcatgaagaa
ctaacccgggacttggagaagcactgccgggatatggaagaagcgagtcagcgcaagtgg
aatttcgactttcagaatcataagcccctggagggcagatacgagtggcaggaggtggag
aggggcagcttgcccgagttctactacaggcccccgcgcccccccaagagcgcctgcaag
gtgctggcgcaggagagccaggatgtcagcgggagccgccaggcggtgcctttaattggg
tctcaggcaaactctgaggaccggcatttggtggaccaaatgcctgactcgtcagacaat
ccggctgggttagcggagcagtgtccagggatgaggaagcgacctgctgcagaagattct
tcttcgcaaaacaaaagggccaacagaacagaagaaaatgtttcagacggttccccgaac
gctggcactgtggagcagacgcccaagaagcccggccttcgacgccagacgtaa

DBGET integrated database retrieval system