KEGG   Mus musculus (mouse): 12578Help
Entry
12578             CDS       T01002                                 

Gene name
Cdkn2a, ARF-INK4a, Arf, INK4a-ARF, Ink4a/Arf, MTS1, Pctr1, p16, p16(INK4a), p16INK4a, p19<ARF>, p19ARF
Definition
(RefSeq) cyclin dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12578 (Cdkn2a)
   04115 p53 signaling pathway
    12578 (Cdkn2a)
   04218 Cellular senescence
    12578 (Cdkn2a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12578 (Cdkn2a)
   05206 MicroRNAs in cancer
    12578 (Cdkn2a)
   05203 Viral carcinogenesis
    12578 (Cdkn2a)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    12578 (Cdkn2a)
   05225 Hepatocellular carcinoma
    12578 (Cdkn2a)
   05214 Glioma
    12578 (Cdkn2a)
   05220 Chronic myeloid leukemia
    12578 (Cdkn2a)
   05218 Melanoma
    12578 (Cdkn2a)
   05219 Bladder cancer
    12578 (Cdkn2a)
   05223 Non-small cell lung cancer
    12578 (Cdkn2a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12578 (Cdkn2a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12578 (Cdkn2a)
   05163 Human cytomegalovirus infection
    12578 (Cdkn2a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    12578 (Cdkn2a)
   01522 Endocrine resistance
    12578 (Cdkn2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_2
Motif
Other DBs
NCBI-GeneID: 12578
NCBI-ProteinID: NP_001035744
MGI: 104738
Ensembl: ENSMUSG00000044303
Vega: OTTMUSG00000007706
UniProt: P51480
LinkDB All DBs
Position
4 C4; 4 42.15 cM
AA seq 168 aa AA seqDB search
MESAADRLARAAAQGRVHDVRALLEAGVSPNAPNSFGRTPIQVMMMGNVHVAALLLNYGA
DSNCEDPTTFSRPVHDAAREGFLDTLVVLHGSGARLDVRDAWGRLPLDLAQERGHQDIVR
YLRSAGCSLCSAGWSLCTAGNVAQTDGHSFSSSTPRALELRGQSQEQS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgctgcagacagactggccagggcggcggcccagggccgtgtgcatgacgtg
cgggcactgctggaagccggggtttcgcccaacgccccgaactctttcggtcgtaccccg
attcaggtgatgatgatgggcaacgttcacgtagcagctcttctgctcaactacggtgca
gattcgaactgcgaggaccccactaccttctcccgcccggtgcacgacgcagcgcgggaa
ggcttcctggacacgctggtggtgctgcacgggtcaggggctcggctggatgtgcgcgat
gcctggggtcgcctgccgctcgacttggcccaagagcggggacatcaagacatcgtgcga
tatttgcgttccgctgggtgctctttgtgttccgctgggtggtctttgtgtaccgctggg
aacgtcgcccagaccgacgggcatagcttcagctcaagcacgcccagggccctggaactt
cgcggccaatcccaagagcagagctaa

DBGET integrated database retrieval system