KEGG   Mus musculus (mouse): 12580
Entry
12580             CDS       T01002                                 

Gene name
Cdkn2c, C77269, INK, INK4c, p1, p18, p18-INK4c, p18-INK6, p18IN, p18INK4c
Definition
(RefSeq) cyclin dependent kinase inhibitor 2C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04110  Cell cycle
mmu04934  Cushing syndrome
mmu05166  Human T-cell leukemia virus 1 infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12580 (Cdkn2c)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12580 (Cdkn2c)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12580 (Cdkn2c)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12580 (Cdkn2c)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    12580 (Cdkn2c)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 12580
NCBI-ProteinID: NP_001288297
MGI: 105388
Ensembl: ENSMUSG00000028551
Vega: OTTMUSG00000008484
UniProt: Q60772 Q9D153
LinkDB
Position
4 C7; 4 51.32 cM
AA seq 168 aa
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPNLKDGTGFAVIHDAARAGFLDTVQALLEFQADVNIEDNEGNLPLHLAAKEGHLPVVE
FLMKHTACNVGHRNHKGDTAFDLARFYGRNEVISLMEANGVGGATSLQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaacgctcaaaatggatttgggagaact
gcgctgcaggttatgaaacttggaaatccggagattgccaggaggcttctcctcagaggt
gctaatcccaatttgaaagatggaactggttttgctgtcattcatgatgctgccagagca
ggtttcctggacactgtacaggctttgctggagttccaggctgatgttaacattgaagat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccctgtggtggag
ttccttatgaagcacacagcctgcaatgtggggcatcggaaccataagggggacaccgcc
ttcgacttggccaggttctatggaagaaatgaggtcattagcctgatggaggcaaatggg
gttgggggagccacaagcctgcagtga

DBGET integrated database retrieval system