KEGG   Mus musculus (mouse): 12606Help
Entry
12606             CDS       T01002                                 

Gene name
Cebpa, C/ebpalpha, CBF-A, Cebp
Definition
(RefSeq) CCAAT/enhancer binding protein (C/EBP), alpha
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12606 (Cebpa)
   05202 Transcriptional misregulation in cancer
    12606 (Cebpa)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12606 (Cebpa)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12606 (Cebpa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12606 (Cebpa)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    12606 (Cebpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 TolA_bind_tri bZIP_Maf Lipoprotein_20 Nup54 DivIC Hema_stalk
Motif
Other DBs
NCBI-GeneID: 12606
NCBI-ProteinID: NP_031704
MGI: 99480
Ensembl: ENSMUSG00000034957
Vega: OTTMUSG00000058155
UniProt: P53566
LinkDB All DBs
Position
7 B2; 7 21.02 cM
AA seq 359 aa AA seqDB search
MESADFYEVEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSA
GAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHAAPALGAA
GLPGPGSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKS
RDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggccgacttctacgaggtggagccgcggcccccgatgagcagtcacctccag
agccccccgcacgcgcccagcaacgccgcctttggctttccccggggcgcgggccccgcg
ccgcccccagccccacctgccgccccggagccgctgggcggcatctgcgagcacgagacg
tctatagacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctcttccagcacagccgacagcaggagaaggccaaggcggcggcgggccccgcgggtggc
ggcggtgactttgactacccgggagccccggcgggccccggcggcgcggtcatgtccgcg
ggggcgcacgggccccctcccggctacggctgtgcggcggccggctacctggacggcagg
ctggagcccctgtacgagcgcgtcggggcgcccgcgctacggccgctggtgatcaaacaa
gagccccgcgaggaggacgaggcgaagcagctggcgctggccggcctcttcccctaccag
ccaccgccgccaccgccaccgccgcacccgcacgcgtctcccgcgcacctggccgccccc
cacttgcagttccagatcgcgcactgcggccagaccaccatgcacctgcagcctggccac
cccacaccgccgcccacgcccgtgcccagcccgcacgctgcgcccgccttgggtgctgcg
ggcctgcctggccccgggagcgcgctcaagggcttggccggtgcgcaccccgacctccgc
acgggaggcggcggcggtggcagcggtgccggtgcgggcaaagccaagaagtcggtggac
aagaacagcaacgagtaccgggtacggcgggaacgcaacaacatcgcggtgcgcaagagc
cgagataaagccaaacaacgcaacgtggagacgcaacagaaggtgctggagttgaccagt
gacaatgaccgcctgcgcaagcgggtggaacagctgagccgtgaactggacacgctgcgg
ggcatcttccgccagctgcctgagagctccttggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system