KEGG   Mus musculus (mouse): 12767Help
Entry
12767             CDS       T01002                                 

Gene name
Cxcr4, CD184, CXC-R4, CXCR-4, Cmkar4, LESTR, PB-CKR, PBSF/SDF-1, Sdf1r, b2b220Clo
Definition
(RefSeq) chemokine (C-X-C motif) receptor 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04670  Leukocyte transendothelial migration
mmu04672  Intestinal immune network for IgA production
mmu04810  Regulation of actin cytoskeleton
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    12767 (Cxcr4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12767 (Cxcr4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12767 (Cxcr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12767 (Cxcr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12767 (Cxcr4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12767 (Cxcr4)
   04672 Intestinal immune network for IgA production
    12767 (Cxcr4)
   04062 Chemokine signaling pathway
    12767 (Cxcr4)
  09158 Development
   04360 Axon guidance
    12767 (Cxcr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12767 (Cxcr4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12767 (Cxcr4)
   05163 Human cytomegalovirus infection
    12767 (Cxcr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12767 (Cxcr4)
   04050 Cytokine receptors [BR:mmu04050]
    12767 (Cxcr4)
   04090 CD molecules [BR:mmu04090]
    12767 (Cxcr4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    12767 (Cxcr4)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CXC Chemokine
   12767 (Cxcr4)
CD molecules [BR:mmu04090]
 Proteins
  12767 (Cxcr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx DUF4564
Motif
Other DBs
NCBI-GeneID: 12767
NCBI-ProteinID: NP_034041
MGI: 109563
Ensembl: ENSMUSG00000045382
Vega: OTTMUSG00000020918
UniProt: P70658 A0A0R4J0N8
LinkDB All DBs
Position
1 E3; 1 56.43 cM
AA seq 359 aa AA seqDB search
MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNRIFLPTIYFIIFLTGIVGNGL
VILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTV
NLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDFIFADVS
QGDISQGDDRYICDRLYPDSLWMVVFQFQHIMVGLVLPGIVILSCYCIIISKLSHSKGHQ
KRKALKTTVILILAFFACWLPYYVGISIDSFILLGVIKQGCDFESIVHKWISITEALAFF
HCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgatcagtgtgagtatatacacttctgataactactctgaagaagtgggttct
ggagactatgactccaacaaggaaccctgcttccgggatgaaaacgtccatttcaatagg
atcttcctgcccaccatctacttcatcatcttcttgactggcatagtcggcaatggattg
gtgatcctggtcatgggttaccagaagaagctaaggagcatgacggacaagtaccggctg
cacctgtcagtggctgacctcctctttgtcatcacactccccttctgggcagttgatgcc
atggctgactggtactttgggaaatttttgtgtaaggctgtccatatcatctacactgtc
aacctctacagcagcgttctcatcctggccttcatcagcctggaccggtacctcgctatt
gtccacgccaccaacagtcagaggccaaggaaactgctggctgaaaaggcagtctatgtg
ggcgtctggatcccagccctcctcctgactatacctgacttcatctttgccgacgtcagc
cagggggacatcagtcagggggatgacaggtacatctgtgaccgcctttaccccgatagc
ctgtggatggtggtgtttcaattccagcatataatggtgggtctcgtcctgcccggcatc
gtcatcctctcctgttactgcatcatcatctctaagctgtcacactccaagggccaccag
aagcgcaaggccctcaagacgacagtcatcctcatcctagctttctttgcctgctggctg
ccatattatgtggggatcagcatcgactccttcatccttttgggggtcatcaagcaagga
tgtgacttcgagagcatcgtgcacaagtggatctccatcacagaggccctcgccttcttc
cactgttgcctgaaccccatcctctatgccttcctcggggccaagttcaaaagctctgcc
cagcatgcactcaactccatgagcagaggctccagcctcaagatcctttccaaaggaaag
cggggtggacactcttccgtctccacggagtcagaatcctccagttttcactccagctaa

DBGET integrated database retrieval system