KEGG   Mus musculus (mouse): 12826Help
Entry
12826             CDS       T01002                                 

Gene name
Col4a1, Bru, Col4a-1, Raw, Svc
Definition
(RefSeq) collagen, type IV, alpha 1
  KO
K06237  collagen, type IV, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12826 (Col4a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12826 (Col4a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12826 (Col4a1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12826 (Col4a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    12826 (Col4a1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12826 (Col4a1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12826 (Col4a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12826 (Col4a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12826 (Col4a1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12826 (Col4a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12826 (Col4a1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12826 (Col4a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12826 (Col4a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   12826 (Col4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 12826
NCBI-ProteinID: NP_034061
MGI: 88454
Ensembl: ENSMUSG00000031502
Vega: OTTMUSG00000021316
UniProt: P02463
LinkDB All DBs
Position
8 A1.1; 8 5.53 cM
AA seq 1669 aa AA seqDB search
MGPRLSVWLLLLFAALLLHEERSRAAAKGDCGGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGI
PGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPP
GVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGYGEKGEPGKQGPRGKPGKDGEKGERGS
PGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMPLGEKGDRGYPGAPGLRGEPGP
KGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSGRDGAPGPPGPPG
PPGQPGHTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGESCLACDTEGLRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLK
GDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDI
GPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFP
GPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNG
LPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGI
RGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPG
PKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPG
LPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIG
PTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPG
SPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGE
KGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSP
GIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPG
INGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKG
LPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPK
GQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAV
HSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt NT seq  +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggcttctgctgctcttcgccgcccttctgctccacgag
gagcgcagccgagcagctgcgaagggcgattgtggtggctctggctgtggaaaatgtgac
tgtcatggcgtgaagggacaaaagggagaaagaggcttgccagggttgcaaggtgtcatt
ggatttcccgggatgcaaggacctgaggggccacatggaccaccaggacaaaagggtgat
gctggagaacctggacttcctggcacaaaagggacgaggggaccccctggagcagctggc
taccctgggaatcccggacttcctggtattcctggccaagatggccctccaggtccccca
ggtatcccaggatgcaacggtacaaagggagagagagggccgctcggtcctcctggcttg
cctggattcagcggcaatcctggaccaccagggttaccaggaatgaagggagatcctggt
gaaattctcggccacgttcccggaacactgctgaaaggggagagaggatttcctggtatc
cccgggatgccgggctcaccagggttgccaggactccagggacccgtgggtcctccggga
tttactggaccaccgggtcctccaggccctcctggacctcctggagaaaagggccagatg
ggctccagcttccaaggaccaaaaggtgacaagggagagcaaggggtcagcggtcccccg
ggagttcctggacaggcacaagttaaggaaaaaggagactttgccccaacaggagaaaag
ggtcagaaaggtgaacctggatttccgggagtaccaggatatggagagaaaggtgaacct
ggcaagcaagggcctcggggaaaacctgggaaagacggtgaaaaaggagaaagggggagc
ccgggcattcctggcgattccgggtacccaggtctcccaggccggcagggcccgcaggga
gagaagggtgaagctggacttccaggcccccctggaactgtgataggcaccatgcctttg
ggagagaaaggagatcgaggctacccaggagcaccagggttgagaggagagcccggccct
aaaggtttccctggaacaccaggccaaccaggccctccaggtttccctactccaggccag
gctggtgctccaggcttcccaggtgaaaggggagaaaaaggtgaccagggatttccaggc
gtgtcattgccaggaccaagtggaagagatggagccccggggcctcccggccctcccggc
ccccctgggcagccaggccacacaaatggcattgtggagtgtcaacctggaccacccggg
gaccagggccctcctgggactccaggacagccaggtttgacaggtgaagttggacagaaa
ggtcagaaaggagagagctgccttgcctgtgacacagaaggacttcgtggccctccaggg
ccacaggggcctccgggagagattggtttccctggacaacctggggctaaaggtgaccga
ggcctgcccggcagagatggtcttgaaggattgccgggtccacaaggttcaccagggctt
ataggccagcctggagctaagggagagcctggagagatattttttgacatgcgactcaaa
ggtgacaaaggagacccaggttttccgggacagcctggcatgccaggaagagcaggaact
cccggaagagatggccacccaggactccctggacccaaaggctctccgggttcaatagga
ttgaaaggagagcgaggtcctcccggaggagttggcttccctggtagtcgtggagacatc
ggccctcctggacccccaggagttggccccattggtcctgttggtgaaaaaggacaagca
ggctttcctggaggccctgggtccccaggtcttccaggcccaaagggtgaggcaggaaag
gttgtcccactccctggccccccaggagctgcaggacttccaggatcccctggcttccca
gggccacaaggtgaccgaggcttcccaggaaccccaggacgtccaggcatcccgggagag
aaaggtgctgtgggccagccaggaattggatttcctgggcttcctggccccaaaggtgtt
gatggcttgcctggagagataggacggcctgggagtccaggtcgccctggatttaacggc
ttacctggcaacccaggacctcaaggtcaaaagggagaacctggcattgggcttccagga
ctcaaagggcaaccaggccttccaggcattcccggtacacctggagagaagggtagcatc
gggggacccggcgttccaggagaacaggggttgacaggccccccaggactccaggggatc
agaggtgacccagggcctcctggagttcaaggcccagcaggtccaccaggggtcccagga
atagggccacccggagctatgggccctcccggagggcaaggaccaccagggtcatcaggt
ccacctggaattaaaggagagaaagggttccctggattccccggactggatatgcctggc
cccaaaggcgataaaggctctcaaggacttcctggcctcacaggacagtcaggcctccct
ggccttcctggacagcaggggacacctggagttccagggttcccaggttctaaaggtgaa
atgggtgtcatgggaaccccgggacaaccaggctcgccaggaccagcaggcaccccaggg
ttacctggagaaaaaggggaccatggccttccgggctcctcaggacccaggggcgaccct
ggcttcaaaggtgataaaggtgacgttgggcttcctggcatgccaggatccatggagcat
gtggacatggggagcatgaagggacagaaaggagaccagggagagaaaggacaaatcgga
cccactggtgataaaggttcccgaggagaccctggaacaccaggagtacctgggaaggat
gggcaggcagggcatcccggacagccagggcctaaaggtgacccaggccttagtgggaca
ccaggatcccctggactccctggacccaaaggatcagttggaggaatgggcttgccaggt
tcgcctggagaaaaaggtgtgcctggcatccctggctcacagggtgtccctggctcacct
ggagagaagggagccaaaggagagaaagggcagtcaggtctacctggcattgggattccg
ggacggcctggtgacaagggagaccagggccttgctggcttcccaggcagccccggtgag
aagggagagaaaggcagtgccggaaccccagggatgccagggtccccaggcccgagaggt
tctccggggaacatcggccatccaggaagcccaggcctgcctggagagaaaggggataaa
ggcctcccaggactggatggcgttcctggtgtcaaaggagaagcaggtctccctgggact
cctggccccacaggcccagctggccagaagggagagccgggcagcgatggaatcccgggg
tcggcaggagagaagggtgaacaaggtgttccaggaagaggcttccccggcttccctggc
tccaaaggagacaaaggctccaagggtgaagtgggtttccctggcctagctggaagtcct
ggaattcctggagtcaaaggcgagcaagggttcatgggtcctcctggccctcaaggacaa
cctggcttacctggcactcctggtcaccctgtggaggggcccaaaggagaccgaggacct
cagggtcaacctggcctgccagggcatccgggacctatggggccgccagggttcccagga
atcaatgggccaaaaggtgacaagggaaatcaaggttggccaggagctccgggggttcca
ggccctaagggagacccaggattccaaggcatgccgggcattggcggctctccagggatc
acaggttcaaagggagatatgggactgcccggagttccaggatttcaaggtcagaaaggg
cttcctggtctgcagggagtgaaaggagaccagggagaccaaggtgtacccggccctaaa
ggtctccaaggtccccctgggcctccaggtccctacgatgtcatcaaaggagaaccaggg
ctccctggtcctgagggtccccctggtcttaaaggactccagggaccaccaggtccaaaa
ggacagcaaggtgtgacaggctcagtgggcttgcctggacctccaggtgtccctgggttc
gatggtgctcctggccagaaaggagagacaggaccctttggaccacctggtccaagaggg
tttcctggcccaccaggccccgatgggctgccaggatccatgggtcccccaggtacccca
tctgtggaccatggcttccttgtgaccaggcatagtcagacaacagatgacccactgtgt
cccccagggaccaaaattctttaccatggatactctctgctctatgtccaaggcaacgag
cgtgcccacgggcaggacttgggtacggctggcagctgcctgcgtaagttcagcaccatg
ccctttctcttctgcaacatcaacaacgtctgcaacttcgcctccaggaacgactactct
tactggctgtccacgccagagcccatgcccatgtccatggcacccatctctggggacaac
atccggcccttcattagcaggtgtgcggtttgtgaagcaccggccatggtgatggcggta
cacagtcagaccattcagattccgcagtgccctaacggttggtcctcactgtggatcggc
tattccttcgtgatgcacaccagcgctggtgctgaaggttccggccaagccctcgcatcc
cccgggtcctgtctggaagagtttagaagcgccccattcatcgagtgccacggcagagga
acgtgcaattactacgcaaatgcttacagcttttggctcgccaccatagagagaagcgag
atgttcaagaagcccacgccatccaccttgaaggcaggggagctgcgaacacacgtcagc
cgctgccaagtgtgcatgagaagaacataa

KEGG   Mus musculus (mouse): 12827Help
Entry
12827             CDS       T01002                                 

Gene name
Col4a2, Col4a-2
Definition
(RefSeq) collagen, type IV, alpha 2
  KO
K06237  collagen, type IV, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12827 (Col4a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12827 (Col4a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12827 (Col4a2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12827 (Col4a2)
  09154 Digestive system
   04974 Protein digestion and absorption
    12827 (Col4a2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12827 (Col4a2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12827 (Col4a2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12827 (Col4a2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12827 (Col4a2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12827 (Col4a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12827 (Col4a2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12827 (Col4a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12827 (Col4a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   12827 (Col4a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 12827
NCBI-ProteinID: NP_034062
MGI: 88455
Ensembl: ENSMUSG00000031503
Vega: OTTMUSG00000021317
UniProt: P08122 B2RQQ8
LinkDB All DBs
Position
8 A1.1; 8 5.62 cM
AA seq 1707 aa AA seqDB search
MDRVRFKASGPPLRGWLLLATVTVGLLAQSVLGGVKKLDVPCGGRDCSGGCQCYPEKGAR
GQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRD
KYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKG
EKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPG
IRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGAR
GDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYL
GPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGD
CQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKG
IKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGL
PGVPGTKGFPGDIGPPGQGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQRDCDTGV
KRPIGGGQQVVVQPGCIEGPTGSPGQPGPPGPTGAKGVRGMPGFPGASGEQGLKGFPGDP
GREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRG
DAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPG
TPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPG
FKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPG
VKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGL
PGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETG
PTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSP
GLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTK
GFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQ
GFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQK
GWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSM
GSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGV
SAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCP
VGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSY
WLSTTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQDTSIPHCPAGWRSLWIGYSF
LMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQ
STPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atggaccgagtgcggttcaaagcgtctggccctcccctgcgagggtggctgctgctagca
actgtgacagtgggactcctggctcagagcgtcttggggggtgtgaagaagttggatgtg
ccctgcggagggagagactgcagtgggggttgccagtgctacccggagaaaggagcaagg
ggtcagccaggggcagtgggcccccaggggtacaatggccccccagggttgcaaggattc
ccaggactacagggccgcaaaggagacaagggcgaacggggagttcctggaccaactgga
ccaaaaggagatgtgggagcgagaggcgtctctggattccccggtgcagatggaattcct
gggcatccagggcaaggcggaccccgaggaaggccaggctacgatggttgcaacggaacc
aggggagacgcgggtccacaggggccctctggatctgggggcttccctggcctccctggg
ccccaaggacccaaggggcagaaaggcgagccttacgcactctctaaagaagaccgtgac
aaataccggggtgaacctggagagcctggcctggttggctaccagggacctcctggccgc
ccagggcccataggacagatgggtcccatgggagcacctggaagaccgggaccaccggga
ccccctggacccaagggacaaccaggcaaccgagggctcggtttttacggacagaagggt
gaaaagggtgacataggacagccaggacccaacgggatcccatctgacatcacacttgtt
gggcccacaacatcaacgatccacccggatctgtacaagggtgaaaaaggagacgaagga
gagcaagggatacccggcgtaatctcaaaaggcgaggaaggcatcatggggttcccagga
atacggggttttcctggccttgatggagaaaaaggagtcgtaggacagaaaggaagcaga
ggcctggatggtttccaaggccccagtggacctcgaggacccaagggagaacggggggaa
caaggacccccaggaccctctgtctactcgccccatccatccctggcaaaaggtgcccga
ggtgacccaggattccaaggtgctcatggggagccaggaagccgaggcgaaccgggagag
cctggaaccgcgggtcctccaggcccatccgtcggagatgaagattcaatgagaggcctt
ccaggggagatgggacccaaaggcttctcaggagaaccagggtcccctgcacgctatctt
ggcccaccaggagcagatggaagaccaggtccccaaggagtccctggacctgcaggccca
cctggaccagatggcttcctgtttggcctgaaaggatcagaagggagagtgggctacccg
ggaccttcaggtttcccaggaacacgagggcagaaaggatggaaaggtgaagctggagac
tgccaatgtggccaggtcatcgggggtcttccgggactgccaggacccaaaggttttccc
ggtgtcaatggggagctcggaaagaaaggcgaccaaggagacccaggcctgcacggtatc
cctgggttcccaggattcaagggagccccgggcgttgctggagctcctggacccaaagga
ataaagggagactctagaacaatcaccaccaaaggggagcgaggacagccaggtatccct
ggtgtacacggaatgaaaggtgatgacggcgtcccaggacgggatgggctggatggattc
cctggcctgcctggccccccgggcgatggcatcaaaggccctccaggggatgcaggtctc
cctggtgtacccggaaccaagggctttccaggagacatcggtcctccaggacagggctta
ccaggtccgaaaggcgagcgtggtttccctggagacgctgggttgcctggacctccgggc
ttccctggtcctccaggtcccccaggaaccccaggacagagagattgtgacacgggtgtg
aaaagacctatcggaggcggccagcaagtggtcgttcagccaggttgcattgaaggcccc
acaggatcacctggccagccaggacccccaggccccacaggtgccaaaggcgtcagagga
atgccaggattcccaggagcttctggagaacaagggctcaagggctttccaggagaccca
ggtcgagaaggcttcccagggcccccagggttcatgggaccccgaggatccaaaggtacc
acaggcctccctggcccagatggacccccaggccccattggacttccaggaccagctgga
ccccctggggacagagggattccaggagaagtgctaggggcccagcctgggacacgagga
gatgctggacttccaggacagcctgggctgaaagggctcccaggagaaacaggagcaccg
ggattcagaggaagccaagggatgcccgggatgccagggcttaaaggtcagccaggcttc
ccaggaccttcgggacagccaggacagtctgggcccccaggacaacatggattcccagga
actcctggccgagaggggcctttggggcagccaggctcccctggccttggaggtttgcct
ggagacaggggcgagcctggtgaccctggtgtccctggccctgtgggcatgaaaggtctg
tctggggacagaggtgacgccggtatgtcaggcgagcgtggtcaccctggaagccctgga
tttaaaggaatggcagggatgcctggtatccctgggcagaaaggtgatcgagggtcgcct
ggaatggacggtttccagggcatgttgggacttaagggaagacagggcttcccagggacc
aaaggagaagctggattttttggagttcctggtttgaagggcctgcctggcgagccaggg
gttaaaggaaaccgaggagaccgggggcccccaggaccacctcctctcatcctgccgggg
atgaaggacatcaagggagaaaagggagatgaaggaccaatgggcctgaaagggtatctg
ggcttaaaaggcatccaaggaatgcccggagtccccggagtgtctggattccctgggcta
cctggaaggcctggcttcatcaaaggagtcaagggagacatcggagtccctggcacacca
ggcttgccgggattccctggggtgtctggccctcctggaattaccgggtttccaggattc
acaggcagccggggcgagaagggtactccaggagtagcaggagtttttggcgagaccggc
cctactggggactttggtgacattggggacactgtggacttaccagggagcccaggcctg
aagggggaacggggcatcacgggaattccaggtctcaagggattctttggagagaaagga
gctgcgggtgacattggatttcctgggataacgggcatggctggagctcagggctctcct
ggacttaaaggacagacaggctttccagggctcacagggctgcaagggccacagggagag
cctggacggatcggaatacccggtgacaagggtgatttcggctggccaggcgtaccaggt
ctaccaggttttcctgggatccggggcatcagcggattgcacggcctgccaggcaccaaa
ggcttccctggatcaccaggtgttgatgctcatggagacccagggttcccaggccccact
ggagacaggggtgaccggggagaggccaacacacttccaggccccgtgggagttccaggg
cagaaaggggagcggggaaccccaggggaacgtggcccagctggaagcccaggacttcag
ggtttccctggtatctctccaccatccaacatctctgggtcacctggtgatgtaggcgca
ccaggaatatttggcttgcaaggctaccaaggccctccaggaccacctgggccaaacgca
cttcctggaatcaaaggagatgaggggagctctggagctgcaggattccctggacagaaa
ggatgggttggggacccagggccccagggccagcctggtgtactcggtcttccgggggag
aaagggcccaagggtgaacaaggattcatgggcaacaccgggccctctggggccgtgggt
gacagaggccccaaaggacccaaaggcgaccaaggattcccaggtgctcctggctctatg
gggtccccaggaattcctggcatcccccagaagattgctgtccagcctggaacgctgggt
ccccagggcaggagaggccttcctggggccctgggagagatagggccgcagggccctcct
ggagatccaggcttccgtggggccccaggcaaggctgggcctcagggcagaggtggcgtg
tctgctgttccagggttccggggagaccaagggcccatgggacaccagggtccagttggc
caggaaggggagccaggccgtccagggagcccaggcctgccagggatgccaggccgcagt
gtgagcatcggctacctcctggtgaagcacagccaaacggaccaggaacccatgtgccct
gtgggcatgaacaagctctggagtgggtacagcctgctatattttgagggccaggagaaa
gcgcacaaccaggacctaggactggcaggctcctgcctggcacgcttcagcaccatgcct
ttcctgtactgcaatccgggtgacgtctgctactatgccagccgcaacgacaagtcctac
tggctctccaccacggcccctctgcccatgatgcccgtggctgaggaggaaatcaagccc
tacatcagccgctgctctgtgtgcgaggctccggccgtggccattgccgtgcacagccag
gatacctctataccccactgcccggctgggtggcggagtttgtggatcggatattcattc
ctcatgcacactgcagccggggatgaaggcggtggccagtcactggtgtcgccgggcagc
tgtctagaggacttccgtgcaacgccatttatcgagtgtaacgggggccgtggtacctgc
cactacttcgctaacaagtacagcttctggctgaccacgatcccagagcagaacttccag
agcacaccatccgctgacacgctcaaggctggcctcatccgcacgcacatcagccgctgc
caagtgtgcatgaagaatctgtga

KEGG   Mus musculus (mouse): 12828Help
Entry
12828             CDS       T01002                                 

Gene name
Col4a3, [a]3(IV), alpha3(IV)
Definition
(RefSeq) collagen, type IV, alpha 3
  KO
K06237  collagen, type IV, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12828 (Col4a3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12828 (Col4a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12828 (Col4a3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12828 (Col4a3)
  09154 Digestive system
   04974 Protein digestion and absorption
    12828 (Col4a3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12828 (Col4a3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12828 (Col4a3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12828 (Col4a3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12828 (Col4a3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12828 (Col4a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12828 (Col4a3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12828 (Col4a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12828 (Col4a3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   12828 (Col4a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 12828
NCBI-ProteinID: NP_031760
MGI: 104688
Ensembl: ENSMUSG00000079465
Vega: OTTMUSG00000021696
UniProt: Q9QZS0
LinkDB All DBs
Position
1; 1 C5
AA seq 1669 aa AA seqDB search
MHSKTAPRFLVFLLLTLLLLLAASPVASKGCVCKGKGQCLCAGTKGEKGEKGVPGSPGFP
GQKGFPGPEGLPGPQGPKGSPGLPGLTGPKGIRGITGLPGFAGPPGLPGLPGHPGPRGLA
GLPGCNGSKGEQGFPGFPGTPGYAGLPGPDGLKGQKGEPAQGEDRGFNGKGDPGPPGVPG
FQGFPGLPGFPGPAGPPGPPGFFGLPGAMGPRGPKGHMGDSVIGQKGERGMKGLTGPPGP
PGTVIFTLTQPYNKSDFKGEKGDEGERGEPGPPGPSGPPGDSYGSEKGAPGEPGPRGKPG
KDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPG
LPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPL
GCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHC
FPGPPGVPGFPGLDGIKGIPGGRGVPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKG
DTPLPWGQVGNPGDPGLRGLPGRKGFDGTPGGPGAKGPPGPQGEPALSGRKGDQGPPGPP
GFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVLGPPGEAGLKGEPSTSTPDLGPPGPP
GPPGQAGPRGLPGLPGPVGKCDPGLPGPDGEPGIPEAGCPGPPGPKGNQGFPGTKGSPGC
PGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTP
GRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPG
IPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGP
PGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGF
VGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGV
PGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKK
GERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPP
GLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGL
PGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPI
GKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKG
NPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPG
IPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTPATGT
RMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMP
FLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVH
SQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGT
CNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH
NT seq 5010 nt NT seq  +upstreamnt  +downstreamnt
atgcactccaagactgctccaaggttcctggtgttcctgctgcttaccctgctgctactc
ctggctgcctctcctgtggctagcaagggctgtgtctgcaaaggcaaaggacaatgcctc
tgcgcggggaccaaaggggagaagggggagaaaggggttcctggttcccctggatttcct
ggccagaaaggatttccaggtcctgaaggcttgcctggaccacagggacccaagggctcc
ccaggacttccgggactcactggccccaaaggcatcaggggaataactggattaccaggg
tttgcaggtcctcctggacttccaggcctcccaggccaccctgggcctcgtgggctggct
ggtttaccaggatgcaacggatctaagggtgaacaaggattcccgggctttcccggcaca
ccaggctatgcagggctcccaggtcctgatggcttgaaaggacaaaagggtgagcctgct
caaggagaagacaggggattcaatggaaaaggtgaccctgggcctccaggggttccaggc
ttccagggttttccgggactcccaggttttccagggcctgccggtccaccaggacctccg
ggattttttggtttaccaggagcaatgggacccagaggacccaaaggccacatgggcgat
agcgtgataggacaaaaaggagaaaggggtatgaaaggattaacaggacctcctgggcca
ccaggaacagtgatttttacactcacccagccatacaacaaatcggacttcaagggagag
aaaggagatgagggagagaggggtgaacccggacctcctggaccctcggggccacctgga
gactcctatggatcagaaaagggtgcgcctggagagcctggtcctcggggcaaacctgga
aaagatggtgcccctggcttccctggcactgagggagccaaaggcaacaggggctttcct
gggttgaggggtgaagctggcattaagggaaggaaaggagacattggccccccaggattt
cctggtccaacagaatattatgacgcatacctggaaaagggagagagaggaatgccaggc
cttcctgggcccaaaggagcccgtggcccacagggtccaagtggtccccctggagtccct
ggaagtcctggactgtcaaggcctggcctcagaggacccattggatggccaggcttgaaa
gggagtaaaggagagagaggaccccctggaaaagacactgtgggccctcctggacccctg
ggatgtcctggctcaccaggtccaccaggccctccaggacctccaggatgtccaggtgac
attgtttttaaatgttcccctggtgagcatggaatgccaggtgacacaggacctccagga
gttccaggacttgatggacccaaaggagaaccaggcagtccatgcaccgagtgtcactgc
ttcccagggccccctggagtcccaggatttccaggattagatggtatcaaaggaatccca
ggaggacgaggtgtgcctggtctgaagggaaacccagggtccccaggaagtgcaggtctc
ccaggatttgcaggattcccaggtgaccaagggcatccaggacttaaaggggacaaaggg
gatacacctctaccctgggggcaagtgggtaatccaggtgatcctggactcagaggcctg
cccgggagaaagggcttcgatggaactcctggaggtccaggagcgaaaggaccaccagga
cctcagggcgaaccggccctgagtggaaggaaaggggaccaaggacctccaggacctcct
ggattccctggacccccaggacctgcaggaccagctggaccaccaggctatggacctcaa
ggagagccaggtccaaagggagcccaaggagtccccggcgtcctgggaccacctggagaa
gccggtcttaaaggagaacccagtacatcaactccagatctaggtcccccaggccctcca
gggccccctggtcaggctggccccagaggtctacctggtttgcctggaccggtgggaaaa
tgtgatcctggtcttcctggacctgatggtgagccaggaattccagaagctggatgccca
gggcctccaggacctaagggaaatcaaggtttcccagggacaaaaggatcacctggttgt
cctggggaaatgggaaagcctggccgtcctggagaaccaggcatcccaggagccaaggga
gaaccatccgtaggcaggcctgggaaaccagggaaaccaggctttccaggagaaagaggc
aatgctggggaaaatggagatattggactccctgggcttccaggcctccctggaactcca
ggaagaggcgggcttgacgggcctccaggagacccaggacagcctggatcacctggagca
aaaggatccccaggaaggtgcataccaggacccaggggcacccaaggacttcccggcttg
aatggattgaaagggcaaccaggtcgaagaggtgataccgggccaaagggagaccctggc
atcccaggcatggacaggtctggggtccccggagatcctggaccaccaggaacaccaggt
tgtcctggtgagatgggaccacctggacaaaaaggatatccgggagctccaggattccca
ggaccaccaggcgagaaaggagaggttggaatgatgggctatcctggaaccactggccct
ccggggcttcctgggaaaccaggctcacaggggcagcgaggtagcctcggaatcccagga
atgaaaggggaaaaaggacgcccaggagccaaaggcgaacgaggagagaaaggaaaacca
gggccttctcaaacaacactcttaaagggagacaaaggagagcctggacttaaaggattt
gttgggaatccaggtgagaaaggaaacagaggcaacccagggttaccaggtccgaaaggc
ctcgagggattgcctgggctaccaggtcctccaggccctagaggagatacgggaagcaga
ggaaatcctggaagaccaggaccacacggcatgccaggaagcatggggatcatgggggtg
ccaggccctaaagggagaaaaggaacttcagggcttccaggtctagctggaagaccaggc
ctgacagggatccatggtccccaaggagataagggggagccgggttattcagaaggtgca
agaccaggaccaccaggaccaaagggcgatccaggattgccaggtgacaaaggaaagaaa
ggagaaagaggcgtacctgggccacctggacaatcggggcctgccggacctgatggagcc
cctgggagtcctgggagtcctggtcacccaggaaaaccaggtcctgctggtgatttgggt
ctgaaaggacagaaaggcttcccaggccctccaggaagcactggccctccaggccctcca
ggactcccaggacttcctgggccaatgggtatgagaggtgaccaaggacgtgatggaatt
cctggtcctccaggagaaaaaggagaaacaggcttgctgggggcctacccaggcccaaaa
gggagccctggtgtaccaggtgccaaaggagacaggggagttccaggcttgtctggcctt
cccggcaggaagggggttatgggggatgttggaccccaaggacccccaggcactgctgga
ctcccagggccaccaggtctacctggggcaattatccctggccccaaaggagacagaggt
cttcctggcttaagaggaaatccaggtgagccaggtccccctggacctccaggacctatc
ggaaaaggcataaaaggtgacaaaggatttatgggcccacctggccccaaaggcctgcct
ggaactgtaggggacatgggcccaccaggtttcccgggagcaccaggtacccccggtctt
cccggtgtcagaggtgatccaggattccctggatttccaggcataaaaggagaaaagggt
aaccctggatttcttgggccaattggacatccaggaccagttgggcccaaaggaccacca
ggtccacgtggaaaacctggcactcttaaggtcatctctcttccgggaagcccagggcca
cctggtgtacctggacagccaggaatgaaaggagaccctggacccctgggactgccagga
atcccaggaccctgtgggccaagaggtaaaccaggcaaggatgggaaaccaggaactcca
ggaccagctggtacaaagggcaacaagggcttgaaaggacagcaaggcccacctggtctg
gatggattgccaggcttaaagggaaatcctggtgacaggggaacgccggccactggtaca
agaatgcgaggcttcatcttcacccgacacagtcaaaccacggccattccttcatgccct
gaaggaacacagccactctatagtgggttttctcttctttttgtacaaggaaacaaacgt
gcacatggacaagacctaggtactctgggcagctgcctgcagcgattcaccacaatgccg
ttcttattctgtaacatcaataatgtatgtaactttgcatcacgaaatgattattcatac
tggctgtcaacaccagctctgatgccaatggacatggctccaattagtggcagagctctc
gaaccctatattagcagatgcaccgtctgtgaaggtccagcaatggccatagctgttcac
agtcaaactactgctatccctccgtgtccccaggactgggtttctctctggaaaggtttt
tctttcattatgttcacaagtgcaggctctgagggtgctggacaagcacttgcctcgcct
ggctcctgcctggaagaattccgagccagtccatttatagaatgccatggacgagggaca
tgtaactactactcaaactcctacagtttctggctggcttcgctgaacccagaaagaatg
ttcagaaaacctattccatcaactgtgaaagctggagacttagagaaaatcataagccgc
tgtcaggtgtgcatgaagaaaagacattga

KEGG   Mus musculus (mouse): 12829Help
Entry
12829             CDS       T01002                                 

Gene name
Col4a4, E130010M05Rik, [a]4(IV)
Definition
(RefSeq) collagen, type IV, alpha 4
  KO
K06237  collagen, type IV, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12829 (Col4a4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12829 (Col4a4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12829 (Col4a4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12829 (Col4a4)
  09154 Digestive system
   04974 Protein digestion and absorption
    12829 (Col4a4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12829 (Col4a4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12829 (Col4a4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12829 (Col4a4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12829 (Col4a4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12829 (Col4a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12829 (Col4a4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12829 (Col4a4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12829 (Col4a4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   12829 (Col4a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 12829
NCBI-ProteinID: NP_031761
MGI: 104687
Ensembl: ENSMUSG00000067158
Vega: OTTMUSG00000021695
UniProt: Q9QZR9
LinkDB All DBs
Position
1; 1 C5
AA seq 1682 aa AA seqDB search
MRCFFRWTKSFVTAPWSLIFILFTIQYEYGSGKKYGGPCGGRNCSVCQCFPEKGSRGHPG
PLGPQGPIGPLGPLGPIGIPGEKGERGDSGSPGPPGEKGDKGPTGVPGFPGVDGVPGHPG
PPGPRGKPGVDGYNGSRGDPGYPGERGAPGPGGPPGQPGENGEKGRSVYITGGVKGIQGD
RGDPGPPGLPGSRGAQGSPGPMGHAGAPGLAGPIGHPGSPGLKGNPATGLKGQRGEPGEV
GQRGPPGPTLLVQPPDLSIYKGEKGVKGMPGMIGPPGPPGRKGAPGVGIKGEKGIPGFPG
PRGEPGSHGPPGFPGFKGIQGAAGEPGLFGFLGPKGDLGDRGYPGPPGILLTPAPPLKGV
PGDPGPPGYYGEIGDVGLPGPPGPPGRPGETCPGMMGPPGPPGVPGPPGFPGEAGVPGRL
DCAPGKPGKPGLPGLPGAPGPEGPPGSDVIYCRPGCPGPMGEKGKVGPPGRRGAKGAKGN
KGLCTCPPGPMGPPGPPGPPGRQGSKGDLGLPGWHGEKGDPGQPGAEGPPGPPGRPGAMG
PPGHKGEKGDMVISRVKGQKGERGLDGPPGFPGPHGQDGGDGRPGERGDPGPRGDHKDAA
PGERGLPGLPGPPGRTGPEGPPGLGFPGPPGQRGLPGEPGRPGTRGFDGTKGQKGDSILC
NVSYPGKPGLPGLDGPPGLKGFPGPPGAPGMRCPDGQKGQRGKPGMSGIPGPPGFRGDMG
DPGIKGEKGTSPIGPPGPPGSPGKDGQKGIPGDPAFGDPGPPGERGLPGAPGMKGQKGHP
GCPGAGGPPGIPGSPGLKGPKGREGSRGFPGIPGSPGHSCERGAPGIPGQPGLPGTPGDP
GAPGWKGQPGDMGPSGPAGMKGLPGLPGLPGADGLRGPPGIPGPNGEDGLPGLPGLKGLP
GLPGFPGFPGERGKPGPDGEPGRKGEVGEKGWPGLKGDLGERGAKGDRGLPGDAGEAVTS
RKGEPGDAGPPGDGGFSGERGDKGSSGMRGGRGDPGRDGLPGLHRGQPGIDGPPGPPGPP
GPPGSPGLRGVIGFPGFPGDQGDPGSPGPPGFPGDDGARGPKGYKGDPASQCGPPGPKGE
PGSPGYQGRTGVPGEKGFPGDEGPRGPPGRPGQPGSFGPPGCPGDPGMPGLKGHPGEVGD
PGPRGDAGDFGRPGPAGVKGPLGSPGLNGLHGLKGEKGTKGASGLLEMGPPGPMGMPGQK
GEKGDPGSPGISPPGLPGEKGFPGPPGRPGPPGPAGAPGRAAKGDIPDPGPPGDRGPPGP
DGPRGVPGPPGSPGNVDLLKGDPGDCGLPGPPGSRGPPGPPGCQGPPGCDGKDGQKGPMG
LPGLPGPPGLPGAPGEKGLPGPPGRKGPVGPPGCRGEPGPPADVDSCPRIPGLPGVPGPR
GPEGAMGEPGRRGLPGPGCKGEPGPDGRRGQDGIPGSPGPPGRKGDTGEAGCPGAPGPPG
PTGDPGPKGFGPGSLSGFLLVLHSQTDQEPACPVGMPRLWTGYSLLYMEGQEKAHNQDLG
LAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLSSAAPLPMMPLSEEEIRSYISRCAV
CEAPAQAVAVHSQDQSIPPCPRTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRA
APFVECQGRQGTCHFFANEYSFWLTTVNPDLQFASGPSPDTLKEVQAQRRKISRCQVCMK
HS
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgctttttcagatggaccaagtcctttgtcacagccccctggtcactaatattt
atcctctttactatacaatatgaatatgggagtggcaagaagtatggcggcccctgcgga
ggaagaaactgctctgtctgccagtgttttcctgagaagggatctcggggtcacccagga
ccactgggaccacagggaccaatagggcccttgggacccctgggacctattgggattcca
ggagaaaaaggagagagaggagacagtggctcacctggaccaccaggagagaaaggagac
aagggtccaactggtgtccctggatttccaggtgtggatggtgtacctggtcacccaggg
cctcctggacccagaggcaaacctggtgtggacggctacaatggctcacgtggtgatccg
ggctatccaggagaaagaggagctccaggcccaggcggcccccctggtcagcctggggaa
aatggagaaaaaggaagatctgtgtacattactggtggcgttaaaggtattcagggagac
cgtggggacccaggaccacccggcttaccaggatctaggggtgcacaagggtcaccaggg
cccatggggcatgcaggcgcaccagggctagcaggacctataggtcatcctggaagccct
gggttgaagggaaatcctgccactggactgaagggacaaaggggagagccgggtgaagtt
ggccagcgtggtcctcctgggcccacgctgttggtacagccgcctgatttgagtatctat
aaaggagaaaagggtgtaaaaggaatgcctggaatgattggtcccccaggacctccaggt
cgcaagggagcgcctggtgtcgggatcaaaggagagaaaggtatccctgggttcccagga
ccccggggtgagcctggttcgcatgggcctccaggttttccaggattcaaggggatacaa
ggagcagctggagagcctgggctgttcggatttcttggtccaaagggggatctgggagat
cgcgggtacccgggaccaccaggcattttgttgactccagctccaccactcaaaggtgtt
ccaggggacccaggaccccctggctactatggggagattggagatgttggattaccaggt
cctccagggcccccaggcagaccaggggaaacttgtccaggcatgatgggacctcctgga
ccaccaggggttcctggtcctccaggatttccaggagaagctggggttcctggaagactc
gactgtgccccaggaaaacctgggaagccagggctacccggcctgcctggcgcaccagga
ccagaggggccccctggatcagatgtgatatactgtcgccctgggtgccctgggccaatg
ggtgaaaagggaaaagtgggtcctccaggaagaagaggagccaaaggagcaaaaggaaac
aagggactctgtacctgtccacctggtcccatgggaccccctggtcccccaggacctcct
ggaagacaaggaagtaaaggagacttagggctccctggttggcatggagaaaagggcgat
ccaggtcagcctggtgctgaaggaccgccagggccaccaggaagacctggtgccatgggg
ccccctggtcacaaaggggaaaagggtgacatggtcatatcaagagtgaaagggcaaaaa
ggagaaagaggactggatgggccaccaggatttccggggccacatggacaagatggtggg
gatggacgtcctggagaaagaggggatcctgggccacgaggggaccataaggatgcagcc
ccgggtgagagagggcttcccggactgccaggccctccaggaagaacaggacctgagggg
cctccaggcctgggatttccaggcccaccaggacagcgaggcctacccggagagcccggg
cgtccgggcaccagaggctttgatggcacgaaggggcagaaaggtgactccattctgtgt
aatgtaagctacccgggaaaaccaggtctgccaggtcttgatggacctccaggtctgaag
gggtttccaggccccccaggggctcctggtatgagatgtccagatgggcagaaaggccag
cggggcaaaccgggaatgtctgggattccaggtccacctggttttcgtggtgacatggga
gatccaggcatcaaaggtgaaaaggggacctcccctattggacccccaggcccacctggg
tctcctggaaaggatggccagaaaggaatcccaggagaccctgcatttggtgacccagga
ccccctggagagaggggtcttccaggagcaccaggcatgaaaggacagaaaggtcaccca
gggtgcccaggggctggaggccctcctggcatccctggatctccaggtctcaaaggtccc
aaaggtagagagggaagtcgtggctttccagggatcccaggatcccctggccattcctgt
gaaagaggtgctcccgggatcccaggacaaccgggacttcctggaactccaggtgatcca
ggggccccaggttggaaaggccagccaggagacatgggtccctctggaccagctgggatg
aagggcctccctggtctcccaggcctaccaggagctgatggtctccgagggcctcctggg
attccaggccccaatggggaagatggtctacctggtcttccaggcctgaagggactccca
gggctgcctggcttccctggttttccaggagagagaggaaagccagggccagatggagaa
cctggaagaaagggagaggttggagagaaaggctggcctggcttgaagggagacctggga
gagcgaggcgccaaaggagacagaggacttcctggtgatgcaggagaagcagtcacttcc
agaaagggtgaacctggggatgctgggcctccaggagatggtgggttctcaggagagaga
ggtgataaaggaagctcagggatgcgagggggaagaggggatcccggaagagatggacta
ccgggactccacagagggcagcctgggatagatgggcctcctgggcctcctgggccccct
ggccctccaggatcacctggactgagaggagtcattggtttcccaggatttccaggtgac
cagggtgatccaggttctccaggaccccctggattcccaggagatgatggagcaagagga
cctaaaggatacaaaggtgaccctgccagtcagtgtggtccacctggtccaaagggtgag
ccaggtagtcctggataccaaggacgtactggagtccccggagagaaaggctttcctgga
gatgaaggaccccgaggaccaccaggcagacctggacagcctggatcttttggaccacca
gggtgtccaggtgacccagggatgcccggactcaagggacatccaggagaagtgggagac
cctgggccaagaggtgatgcgggagatttcgggaggccaggtcctgctggagtgaaaggg
cctctcgggtctcctggtctgaatggcttacatggtctgaagggtgagaaaggaacaaaa
ggcgcctcaggtttgctcgaaatgggtccacctgggccaatggggatgcctgggcaaaaa
ggagagaaaggagaccctgggagtccagggatttctcctccaggtcttcctggagaaaag
ggcttcccaggacccccagggagaccaggaccacctggtcccgcaggtgccccaggaaga
gctgctaaaggtgacattcctgatccaggtccacctggagaccggggacctcctggcccc
gatggcccaagaggagtacctgggcctccgggttcccctgggaatgttgaccttctgaaa
ggggacccaggtgactgtggtttgccaggaccacctggctcccgaggcccaccaggccct
ccagggtgtcagggtcccccaggatgtgatggcaaagatggccagaaaggaccaatggga
cttccagggttgccagggccacctggtcttcctggggcacctggcgagaagggattacct
ggccctccaggcagaaaagggccagtaggtcctccaggctgcagaggtgaacctgggcct
cctgcagacgtggattcctgtcctcgaatcccaggacttcctggagtgccaggtcccaga
ggaccagaaggagctatgggggaacctggacggagaggcctgcctggaccagggtgcaaa
ggagagcctggaccggatggcagacggggccaggatggcatccctggatctcccgggcct
cctggacgcaaaggtgacactggagaggcagggtgtcctggagcaccaggccctcctggt
ccaactggtgatcctgggcccaaggggtttggccctggatcgctcagtggcttcctcctg
gttctccacagtcagactgaccaggaaccggcctgccccgtgggcatgcctcggctttgg
acagggtacagcttgttgtacatggaaggacaggagaaggcgcacaatcaagatcttggt
ttggcaggctcttgtcttcctgtgtttagcactctgccctttgcctactgcaacatccac
caagtgtgccactacgcccagagaaatgacaggtcctactggctgtccagtgcggctcct
cttcctatgatgccactctcagaggaagagatccgctcttacatcagccgctgtgcggtg
tgtgaggccccagcacaggccgtggcggtccacagtcaggaccaatccatcccaccgtgt
ccacggacatggaggagtctctggattgggtactcatttctgatgcacactggagctggg
gaccaaggaggtgggcaggcactgatgtcacctggcagctgcctagaggacttcagagct
gcaccgttcgttgaatgccagggccgacagggaacctgtcacttttttgcaaacgagtac
agcttctggctgaccaccgtgaacccagacctgcagtttgcctctggcccgtcaccagac
accttgaaagaagttcaggcccagcgccggaaaatcagcaggtgccaggtttgcatgaag
cacagctaa

KEGG   Mus musculus (mouse): 12830Help
Entry
12830             CDS       T01002                                 

Gene name
Col4a5
Definition
(RefSeq) collagen, type IV, alpha 5
  KO
K06237  collagen, type IV, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12830 (Col4a5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12830 (Col4a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12830 (Col4a5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12830 (Col4a5)
  09154 Digestive system
   04974 Protein digestion and absorption
    12830 (Col4a5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12830 (Col4a5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12830 (Col4a5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12830 (Col4a5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12830 (Col4a5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12830 (Col4a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12830 (Col4a5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12830 (Col4a5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12830 (Col4a5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   12830 (Col4a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 12830
NCBI-ProteinID: NP_001156627
MGI: 88456
Ensembl: ENSMUSG00000031274
Vega: OTTMUSG00000018954
UniProt: Q63ZW6
LinkDB All DBs
Position
X F2; X 62.16 cM
AA seq 1691 aa AA seqDB search
MQVRGVCLAAGWFLLALCLWGQPAEAAACHGCSSGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSPLPGPKGNQGYPGPPG
IQGPPGPKGISGPSGPPGPPGLMGPPGPPGPPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDIEFQKGDQGVPGDRGPPGPPGIPGPPGPPGGVKGEKGEPGEAGKRGKP
GKDGETGQPGIPGLPGDPGYPGEPGRDGEKGQKGDIGPPGPPGLVIPAPGTGVTMGEKGN
IGLPGLPGEKGERGFPGIQGPPGFPGPPGTAVVGPPGPPGYPGERGQKGDEGPPGICIPG
SPGLDGQPGAPGLPGPPGPPGPQLPSRDEICKAGPPGPPGPPGDKGLQGERGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGIPGEKGDKGQAGITGPKGLPGIPGPPGAPGF
PGSKGDPGDVLTLPGMKGDKGELGFPGAPGLPGLPGSPGKDGLPGLPGPKGEPGGITFKG
ERGPPGSPGLPGLPGNMGPTGPVGFGPPGPIGEKGIQGVAGNPGQPGLPGPKGDPGQTIT
QPGKPGLPGSPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGPPGPPGPKGFPGI
PGPPGAPGAPGRMGPDGPPGPPGFPGPKGEPGFGLPGPPGPPGFPGFKGTPGPKGDRGFP
GPSGPPGRTGLDGLPGPKGDVGPNGQPGPVGPPGLPGIGLQGPPGPPGTPGPIGQPGLHG
IPGEKGDPGPPGFDVPGLPGERGSPGLPGAPGLIGPPGSPGVPGKAGVPGFPGVKGEMGM
MGPPGPPGPLGIPGRSGAPGLKGDDGMQGQPGLPGPAGEKGGKGEPGLPGPPGPMHPDFL
GSKGEKGEPGLPGIPGLSGPKGYQGLPGDPGQPGLSGQPGSPGLPGPKGNPGLPGPPGLT
GPPGPKGNIGDMGFPGPQGVDGPPGPPGFPGQPGSPGLPGQKGSKGEPGVSGIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGETGLPGLPGNPGAKGQPGLPGFPGTPGLPGPKGMNGPPG
NPGFPGEPGPVGAGGRPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGL
SGQKGDGGSPGLPGNPGLPGSKGEPGFQGFPGMPGPPGPPGSPGQALEGPKGNPGPQGPP
GRPGPPGFQGPPGTEGPRGPPGNGGIKGERGNPGPPGQPGLPGLKGDQGPPGLPGNPGRP
GLNGMKGDPGLPGVPGFPGMKGPIGVPGSTGPDGEPGLTGPPGPPGLPGPSGQSIVIKGD
PGPPGIPGQPGLKGLPGLPGPQGLPGPIGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGA
RGLDGPPGPDGLQGPPGPPGTTSVAHGFLITRHSQTTEAPQCPRGTVHIYEGFSLLYVQG
NKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMNMEPLKG
QSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQAL
ASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDMSDMFNKPQSETLKAGDLRTR
ISRCQVCMKRT
NT seq 5076 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgcgtggagtgtgcctggctgccggctggttcttactggccctgtgtctgtgg
gggcagcccgcagaggctgcggcctgccatgggtgttcttctggatcaaaatgtgactgc
agtggtataaaaggagaaaagggagaacgggggtttccaggtttagaaggtcatccaggt
ttaccaggatttccaggtccagaaggccctccaggacctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaaggaatcagaggtcctcctggacttcctggattt
ccagggacaccaggtcttcctgggatgccaggccatgatggggctccaggacctcaaggt
atccctggatgcaatggaaccaagggagaacgtggatttccaggcagtccgggctttcct
ggtttacaaggtcctccaggacctcctgggatcccaggtatgaagggggaaccaggcagt
ataatcatgtcaccactgccaggaccaaagggtaatcaaggatacccaggtcctcctgga
atacaaggcccacctggtcccaagggtatatcagggccaagtggtcctccaggaccacca
ggtttaatgggacctcctggcccaccaggcccaccgggaccaaaggggaatatgggctta
aatttccagggacccaaaggtgaaaaaggcgaacaaggtcttcagggcccacctggtcca
cctgggcagatcagcgaacagaaaagaccaattgacatagaatttcagaaaggagatcag
ggagttcctggtgatagagggcctcctggacctccaggaatacctggtcctcccggtcct
cctggtggtgtgaaaggtgaaaagggtgagccaggagaggcaggcaaaagaggtaaacca
ggcaaagatggagagactggccaaccaggaatcccaggtttgcctggtgatcctggttac
cctggagaaccaggaagagatggtgaaaagggtcaaaagggtgatattggcccacctgga
cctcccggacttgtaattcctgcacctggaactggtgtgactatgggagaaaaaggaaat
atcgggttacctggtttgcctggagaaaagggagagcgaggatttcctggaatacaaggt
ccacctggctttcctggacctccaggaacagcagttgtgggtccccctggtcctcctgga
tatcctggtgaaaggggccagaaaggtgatgaaggtccccctggaatttgtattcctgga
tctcctggacttgatggacagcctggggctcctggccttccaggacctcctggcccccct
ggcccccagttgccatccagagatgaaatctgtaaagcaggccctcctgggcctccagga
cctccaggtgataaaggactccaaggagagcgaggagtaaaaggtgacaaaggtgatact
tgcttcaactgtattggaactggcatttcagggcctccaggccaacctggtttaccaggt
ctcccaggtcctccaggatctcttggaatccctggagagaagggggacaaaggacaagct
gggataactggtccgaaaggattgccaggcatacctggacctccaggtgctccaggcttt
ccagggtctaagggtgaccctggggatgtcctcactcttccaggaatgaaaggtgacaaa
ggagagttgggtttccctggagctccagggcttcctggtctacctggtagtcctggaaag
gatggtttgccaggactccctggccccaaaggagagcctggtggaattacttttaagggt
gaaagaggtcctcctgggagcccaggtttaccaggtctcccaggaaatatgggacctaca
ggcccagttggttttgggcctccaggccccataggcgaaaaaggcatacaaggtgtggca
ggaaatccaggccagccgggattaccaggtcctaaaggagatccaggccagaccataacc
cagccaggaaagcctggtttgccaggtagtccaggcagagatggtgaagtgggtcttcca
ggtgatcctggacttccaggccaaccaggcctgccaggaatacctggtagcaaaggagaa
ccaggtatccctgggattgggcctcctggaccacctggtcctaaaggttttccaggaatt
ccgggacctccaggagctcctggggcccctggaagaatgggtccagatgggcctcctggg
ccaccaggcttcccaggaccaaagggagagccaggatttgggttacctgggccacctggg
ccaccaggattcccaggtttcaaaggaacacctggtccaaaaggtgatcgtggtttccca
ggaccttcaggtcctccaggacgcactggcttggatgggctacctggaccaaaaggtgat
gttggaccaaatggacaacctggcccagtagggcctccagggctgccaggaattggtctt
cagggaccaccaggaccaccagggactccagggccaataggccaacctggcttacatggg
attccaggagagaagggggacccaggacctcctgggtttgatgttccaggactccctgga
gagagaggtagtccagggctccctggagcccctggtcttataggacctccaggatcacct
ggtgtccctggaaaagcaggtgtccctggatttccaggtgtcaaaggcgaaatgggtatg
atgggacctccaggcccacctggacctttgggaattcctggcaggagtggtgctcctggt
cttaaaggtgatgatggcatgcaaggtcagccaggtctccctggccctgcaggagaaaag
ggcggtaagggagagcctggccttccaggtcctcctggaccaatgcatccagatttcctg
ggatcgaaaggagaaaagggtgagcccggcttaccaggtattcctggactttcaggacca
aaaggctaccagggattacctggagacccagggcaacctggactgagtggacaaccagga
tcaccaggactcccaggtcccaagggtaatcctggtctccctggtccaccaggacttaca
ggacctcctggaccaaaaggaaacattggtgacatgggttttcctggccctcaaggtgta
gatgggccccctggacctcctggatttcctggacaacctggctctcctgggttacctggc
cagaaaggaagtaaaggagagcctggggtttcaggcattggacttccaggtcttcctggc
ccaaagggtgaacctggtctgcctggatatccaggaaacccaggtatcaaagggtcggtg
ggagagactggtcttcctggattaccaggaaaccctggagcaaaaggtcaaccgggcctg
cctggattcccaggaacaccaggacttcctggaccaaaaggtatgaatggtcctcctggt
aaccctggctttcccggagaacctggtcctgtaggtgccggagggcgtcctggaccacca
ggacctcctggtgaaaaaggcaagccaggtcaagatggcattcctgggccagcaggacaa
aagggagaaccaggtcaaccaggctttggaatcccaggacctcctggactcccaggactt
tctggacaaaagggtgatggaggatcacctggacttccaggaaatcctggccttccaggt
tcaaagggtgagccaggctttcagggattccctggtatgccaggtcccccaggtcctcct
ggttctcctggtcaagctttggaaggtcccaaaggaaaccctgggcctcaaggccctcct
gggagaccaggtcctccaggttttcaaggtccaccaggtacagaaggtcctcgtggaccc
cctggaaatggaggtatcaaaggagagaggggaaatccaggcccacctgggcagccaggc
ttacctggtttgaaaggagatcaaggaccaccaggactcccgggtaaccctggccggcca
ggtcttaatggaatgaaaggagatcctggtctccctggtgttccaggattcccaggaatg
aaaggacccattggagtaccaggctccactggccctgatggggaaccaggtcttactggg
cccccaggtcctcctgggttgcctggtccttcaggacagagtattgtaatcaaaggagat
cctggacctccagggattcctggacaacctggattaaaaggtctaccaggacttccaggc
cctcaaggcctaccaggtccaattggccctccaggagatccaggacgcaatggactccca
ggctttgatggtgcaggagggcgcaaaggagacccagggctgccaggacagccaggtgcc
cgtggattggatggtcccccaggaccagatggattgcaaggacctccaggaccccctgga
accacctctgttgcccatggattcctcatcacacgtcacagtcaaacaacagaagcacca
caatgcccacggggaacagttcatatctatgaaggcttttctctcctgtatgtacaagga
aataaaagagcccatggtcaagacttgggtacggctggcagctgccttcgtcgcttcagt
accatgcctttcatgttctgcaacattaacaacgtttgtaactttgcttcaagaaatgac
tattcttactggctttccaccccagagcccatgccaatgaacatggaacccctgaaggga
cagagcatccagccattcattagtcgatgtgcagtgtgtgaggcgccagctgtggtgatc
gctgttcacagccagactattcagattccacactgtcctcaggggtgggactctctgtgg
attggctattccttcatgatgcatacaagtgcaggagcagaaggctctggccaagcccta
gcctctcctggctcctgtttggaagaatttcgttccgctcccttcatcgaatgtcatggg
cgagggacatgcaattactatgccaattcgtacagcttttggctggccactgttgatatg
tcagacatgttcaacaaacctcagtcagaaaccctgaaagcaggagacttgaggacgcgt
attagccgatgtcaagtatgcatgaagaggacataa

KEGG   Mus musculus (mouse): 14268Help
Entry
14268             CDS       T01002                                 

Gene name
Fn1, E330027I09, Fn, Fn-1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    14268 (Fn1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    14268 (Fn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14268 (Fn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14268 (Fn1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14268 (Fn1)
   05205 Proteoglycans in cancer
    14268 (Fn1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    14268 (Fn1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    14268 (Fn1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    14268 (Fn1)
   05100 Bacterial invasion of epithelial cells
    14268 (Fn1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14268 (Fn1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14268 (Fn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14268 (Fn1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14268 (Fn1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14268 (Fn1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    14268 (Fn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   14268 (Fn1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   14268 (Fn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF4959 DUF4912 MG4
Motif
Other DBs
NCBI-GeneID: 14268
NCBI-ProteinID: NP_034363
MGI: 95566
Ensembl: ENSMUSG00000026193
Vega: OTTMUSG00000048807
UniProt: P11276 Q3UZF9
LinkDB All DBs
Structure
PDB: 

Position
1 C3; 1 36.05 cM
AA seq 2477 aa AA seqDB search
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYKVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAGSGSFTDVRTAIYQPQTHP
QPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGNSNGALC
HFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWKEATIP
GHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTRFDFTTSASTPVTSNTVTGETAPYSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGT
PRSDNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTF
AEITGLSPGVTYLFKVFAVHQGRESNPLTAQQTTKLDAPTNLQFVNETDRTVLVTWTPPR
ARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEYTVTLVAVKGNQQSPKATGV
FTTLQPLRSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYTYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISD
TVVPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVG
YYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPP
PSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPL
RGRQKTGLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSR
NSITLTNLNPGTEYVVSIIAVNGREESPPLIGQQATVSDIPRDLEVIASTPTSLLISWEP
PAVSVRYYRITYGETGGNSPVQEFTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPAS
SKPVSINYKTEIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTA
SPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKI
AWESPQGQVSRYRVTYSSPEDGIRELFPAPDGEDDTAELQGLRPGSEYTVSVVALHDDME
SQPLIGIQSTAIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINL
SPDSSSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTI
TISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTITGLQPGTDYKIHLYTLNDNA
RSSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI
LDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVR
LRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESS
EYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTV
GNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKW
CHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPI
ECFMPLDVQADRDDSRE
NT seq 7434 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggggtccgggacccgggcggctgctgctgctggcagtcctgtgcctggggacc
tcggtgcgctgcaccgaagccgggaagagcaagaggcaggctcagcaaatcgtgcagcct
caatccccggtggctgtcagtcagagcaagcctggctgttttgacaatgggaagcactat
cagataaatcagcagtgggaacggacctacctaggcaacgccctggtttgtacctgctat
ggaggaagccggggttttaactgcgagagcaagcctgagcctgaagagacttgctttgac
aaatacactgggaacacttacaaagtgggtgacacttatgagcgccctaaagattccatg
atctgggactgtacctgcatcggggctgggagaggcaggatcagctgtaccattgcaaat
cgctgccatgaagggggtcagtcctacaagattggcgacaagtggaggaggccacatgag
actggtggctacatgttagagtgtctgtgtctgggaaatggaaaaggggaatggacctgc
aaacctatagctgagaagtgttttgatcatgctgctgggacgtcctacgtcgtgggggag
acctgggaaaagccctaccaaggctggatgatggtggactgtacttgtctaggcgaaggc
aatggacgcatcacctgtacctccagaaacagatgcaacgatcaggacacccggacatcc
tataggattggagacacgtggagcaagaaggacaaccgaggaaacctgcttcagtgtgtc
tgcacaggcaatggcagaggggagtggaagtgtgagcgacatgctctacaaagtgcttca
gccggatctggctccttcactgatgtccgaacagctatttaccaaccgcagactcacccc
cagcccgctccctacggccactgtgtcaccgacagtggtgtggtctactctgtgggaatg
cagtggctgaagtcgcaaggaaacaagcaaatgctgtgcacgtgcctgggcaatggcgtc
agctgccaggagacagccgtgacccagacttatggtggcaattcaaacggggagccctgt
gtcctcccgttcacctacaacggtaggaccttctattcctgcaccaccgaagggcggcaa
gacggacatctgtggtgtagcacaacttccaattacgaacaagaccagaagtattccttc
tgcacagaccatgcggttttggttcagactcgaggcggaaattccaatggtgctctgtgc
cacttccccttcctgtacaacaaccggaattacaccgactgtacttctgagggtcgcagg
gacaacatgaaatggtgcggcaccacccagaactacgatgccgatcagaagtttggattc
tgcccaatggctgcccacgaggagatctgcacaaccaatgaaggggtcatgtatcgcatt
ggggatcagtgggataagcagcatgacctgggccacatgatgaggtgcacgtgtgtgggg
aacggtcgtggagaatgggcctgcatcccctactcccagctccgagaccagtgcatcgtt
gatgacattacttacaatgtgaacgacacgttccacaagcgtcacgaggagggacatatg
ctgaactgtacctgctttggtcagggccggggcagatggaagtgtgaccccattgaccag
tgccaagattcagagacccggacattttaccagattggtgactcctgggagaagtttgtg
catggtgtccgataccagtgttactgctacggccgtggcatcggggagtggcactgtcaa
cctctgcagacctacccaggcacaactggacctgtccaagtaattatcacggagaccccc
agccagcccaattcccaccccatccagtggaatgccccggagccttcacacatcaccaag
tacattctcagatggagacctaaaacctctacgggtcgctggaaggaagctaccattcct
ggccaccttaactcctataccatcaaaggcctgaccccaggtgtgatctatgagggacag
ctcatcagcatccagcagtatggccacagagaagtgacacgcttcgacttcaccaccagc
gccagcacccctgtgaccagcaacacggtgaccggagagactgcgccctactctcctgtt
gtggccacttctgaatctgtaactgaaatcacagccagcagctttgtggtctcatgggtc
tcagcctccgacaccgtgtcaggcttccgggtggagtatgagctgagcgaggagggagat
gaaccacagtaccttgatctcccaagcacggccacttccgtgaacattcctgacctgctc
ccgggcagaaagtacattgtcaatgtctatcagatatctgaggagggaaaacagagcttg
atcctgtctacctcacagactacagcacctgacgctcctccagaccctaccgtggaccag
gttgatgatacttccattgttgttcggtggagtagaccccaggcacctatcacagggtat
agaattgtctattcaccttcagtagaaggcagtagcacagagctcaacctccctgaaacg
gccaactccgtcaccctcagcgacctgcagcccggtgttcagtacaacatcactatctat
gctgtggaggagaaccaggagagcacacccgttttcatccaacaagagaccactggcacc
ccaagatctgataacgtcccccctccgacggacctacagtttgtggaactgactgatgtg
aaagtcaccatcatgtggacccctcctgatagtgtggtgtctggataccgtgtggaggtc
ctgcctgtcagcctgcccggggaacatgggcagaggctgcctgtcaacagaaataccttt
gctgaaatcactgggctgtcccctggggtcacgtacctcttcaaagtctttgctgtgcac
cagggcagggaaagcaatcctctgacggcacaacagaccaccaaactcgacgctcccact
aacctccagtttgtcaatgaaactgacagaacagttctggtaacgtggactccacctcga
gcccgtatagcaggctaccgactgaccgcgggcctgacccgaggaggccagcccaagcag
tacaatgtgggacccttggcctccaagtatcccctgagaaatctgcagcctgggtctgag
tacaccgtgaccttggtggctgtgaaagggaaccagcagagtcccaaagccaccggagtc
tttactaccctgcagcctctgcgctccattccaccttacaacaccgaggtgacagagacc
acaattgtgatcacctggacccccgctccaaggattggcttcaagctgggtgtacgaccg
agccagggaggtgaggcaccccgagaagtgacttcagactctgggagcattgttgtgtct
ggcttgactccaggcgtggaatacacttacaccatccaagtcctgcgagatggccaggag
agagatgcaccgattgtcaacagagtagtgacaccgctgtctccaccgaccaacttgcat
ctggaggcaaaccctgacactggagtgcttactgtctcctgggagaggagcactacccca
gatatcactggctacagaataactactacccccacgaacgggcagcaggggacctctctg
gaagaagtggtccatgctgatcagagttcctgcacttttgagaacctgaatcctggcctg
gagtacaacgtcagtgtttacactgtcaaagatgacaaggaaagtgcccctatctctgat
accgttgtcccagaggtgccccagctcactgacctaagctttgttgatataactgattca
agcatcggcctgaggtggaccccgctaaactcttccaccattatcgggtaccgaatcaca
gtagttgcggcaggagaagggatccctatttttgaagattttgtggactcctcagtagga
tactacacagttacagggctggagcctggcattgactatgacatcagcgttatcactctc
attaatggcggagagagtgcccctactacactgacacagcaaacggctgtccctcctccc
acggatctgcgattcaccaatatcggtccagacacgatgcgggtcacttgggccccgcct
ccgtccatcgagctgaccaacctcttggtgcgctactcacccgtgaagaatgaagaggac
gttgcagagctatccatttcaccttcagacaatgccgtggtcctaacaaatctcctgcct
gggacagaatacttagtcagtgtctccagtgtctacgaacaacatgagagcatccctctc
cggggaaggcagaaaacaggtctcgattccccaactggttttgattcttctgatatcacc
gccaactcattcactgtccactgggtggctcctcgggcccccatcaccggctacatcatc
cgccatcacgccgagcattctgtcggaagacccaggcaggatcgagtgccgccctcgcgg
aattccatcaccctcaccaaccttaatccgggcaccgagtacgttgtcagcatcattgct
gttaatggcagagaggagagcccgccactgattggccagcaagccacagtttctgatatt
ccgagagatctggaggtcattgcctccacccccaccagcctgctcatcagttgggaaccc
cctgccgtctctgtgcgctattacagaatcacctacggagagacaggaggaaatagccct
gtccaggagttcactgtgcccggaagcaagtccacagccaccatcaacaacattaaacca
ggagcagactacaccatcaccctgtatgctgtcactggccgtggggacagtccagcaagc
agcaagccagtttccatcaattataaaacagaaattgacaagccgtcccagatgcaggtg
acagatgtccaggacaacagcatcagtgtcaggtggctgccttcaacttctcctgtgaca
ggctacagagtgaccaccactcccaaaaatggcctaggaccatcaaaaactaaaactgcc
agtccagatcaaacagaaatgaccattgaaggtttgcaacccactgtggagtacgtggtt
agtgtttatgctcagaaccggaacggagaaagccagcccctggttcaaactgcagtgacc
aacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaaatt
gcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccctgag
gatggaatccgggagcttttccctgcacctgatggtgaagacgacactgcagagctgcag
ggcctcaggccggggtctgagtacacagtcagtgtggttgccttgcacgatgatatggag
agccagcccctgattggaatccagtccacagccattcctgcgcccaccaatctgaagttc
agtcaggtgacacccaccagctttactgcccagtggatagcacccagtgttcagctcact
ggctaccgggtgcgggtgaacccgaaagagaagacaggaccaatgaaagaaatcaacctt
tctccagacagctcatcggtgattgtgtcaggactcatggtggccactaaatacgaagtc
agtgtctatgctctcaaggacacactgacaagcagaccagcccagggagtcatcactact
ctggagaatgttagccctccaagaagggcccgtgtgacggacgctacagagaccaccatc
actattagctggagaacaaagacagagacaatcactggcttccaagtcgatgccatccca
gccaatggccagaccccagttcagaggagcatcagcccggatgttagaagctacaccatt
acaggtttacagccaggcactgactacaagatccacctgtacactctgaacgacaatgcc
cggagctcgcccgtgatcatcgatgcctccaccgccatcgacgcaccatccaacctgcgg
ttcctgaccaccacacccaactccttgctggtgtcatggcaggcgccccgtgccaggatt
actggctacattatcaagtatgagaagcctggatcccctcccagagaagtggtccctcgg
ccccgccctggtgtcacggaggccaccattactggtctggagccaggaaccgagtacacc
atctacgtcattgccctgaagaacaatcagaagagtgagcccctgattgggaggaagaag
acagatgagcttccccaactggttacccttccacaccccaatcttcatggaccagagatc
ttggatgttccctccacagttcaaaagacccccttcatcaccaaccctgggtatgacacc
gaaaatggtattcagcttcctggcacaacccaccagcaacccagtgttgggcaacaaatg
atctttgaggaacatggctttaggcggacaacgccacccactgcggccacccccgtcagg
cttaggccaagaccatacctgccgaatgtagatgaggaggtccaaatcggtcatgttccc
aggggagacgtagactaccacctctatcctcatgttccgggcctcaatccaaatgcctct
acaggacaggaagctctctctcagacaaccatctcttggacgccgttccaggagagttct
gagtacatcatttcatgccaaccagttggcaccgacgaagagcccttacagttccaagtt
cctggaacttctaccagtgcgactctgactggccttaccagaggggtcacctacaacatc
atagtggaggcactgcagaaccagaggaggcacaaggttcgggaagaggttgtgactgtg
ggcaacgctgtcagcgaaggcctgaaccagcctacagatgactcatgctttgacccttac
acggtttcccattacgccattggagaggagtgggagcggttgtctgacgctggctttaag
ctcacatgccagtgcttgggctttggcagtggtcatttcagatgcgattcatctaaatgg
tgccatgacaacggtgtcaactacaagatcggagagaagtgggatcggcagggagaaaat
ggccagcggatgagctgcacatgcctcgggaatggaaagggagaattcaagtgtgatccc
catgaagcaacgtgctatgacgatgggaagacctaccatgtaggagaacagtggcagaaa
gaatatctcggagccatttgctcctgcacgtgtttcggaggccagcggggctggcgctgt
gacaactgccgtagacctggggctgctgaacccagtcccgatggcaccaccggccacacc
tacaaccagtatacacagagatacaatcagagaacaaacactaacgtaaattgccccatt
gagtgcttcatgccgctagatgtgcaagctgacagagacgattctcgagagtaa

KEGG   Mus musculus (mouse): 16772Help
Entry
16772             CDS       T01002                                 

Gene name
Lama1, AA408497, Lama
Definition
(RefSeq) laminin, alpha 1
  KO
K05637  laminin, alpha 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16772 (Lama1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16772 (Lama1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16772 (Lama1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16772 (Lama1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16772 (Lama1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16772 (Lama1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16772 (Lama1)
   05145 Toxoplasmosis
    16772 (Lama1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF2520 Hepar_II_III
Motif
Other DBs
NCBI-GeneID: 16772
NCBI-ProteinID: NP_032506
MGI: 99892
Ensembl: ENSMUSG00000032796
UniProt: P19137
LinkDB All DBs
Structure
PDB: 

Position
17 E1.1; 17 38.8 cM
AA seq 3083 aa AA seqDB search
MRGSGTGAALLVLLASVLWVTVRSQQRGLFPAILNLATNAHISANATCGEKGPEMFCKLV
EHVPGRPVRHAQCRVCDGNSTNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTVTLDL
RQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGPPT
YRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPSPQLLEFTSARYIRLRLQRIRT
LNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEEAKQLQCQCE
HNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAG
QYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDD
RHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCRTVGSLNEDPCIEPCLC
KKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDL
MSTNKIRSQQDVLGGHRQISINNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSY
DIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRRE
IDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAVAADVEHCECPQ
GYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECDIHGICSVCTHNTTGDHCEQCL
PGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCAD
GYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDA
VTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNC
SVEGSVSDNCTEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGE
CLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQS
CHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQ
AGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEG
VHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSN
YEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSV
LSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSC
QDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCEL
CASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSA
GYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDC
VSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKI
RAEIQLEGIAEQTENLQKELTRVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITE
KVATLNQTARKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI
QKRFQKPQEKLKALKEANSLLSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQ
EKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVD
DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLT
EEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLDELK
NLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALS
LRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEE
NLSRNLSEIKLLISRARKQVASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDN
LLFYLGSSSSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMG
SLSVKEASAAENPPVRTSKSPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMG
EAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILF
STFSPNGLLFYLASNGTKDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQ
RNRKQGLLAVFDAYDTSDKETKQGETPGAASDLNRLEKDLIYVGGLPHSKAVRKGVSSRS
YVGCIKNLEISRSTFDLLRNSYGVRKGCALEPIQSVSFLRGGYVEMPPKSLSPESSLLAT
FATKNSSGILLVALGKDAEEAGGAQAHVPFFSIMLLEGRIEVHVNSGDGTSLRKALLHAP
TGSYSDGQEHSISLVRNRRVITIQVDENSPVEMKLGPLTEGKTIDISNLYIGGLPEDKAT
PMLKMRTSFHGCIKNVVLDAQLLDFTHATGSEQVELDTCLLAEEPMQSLHREHGELPPEP
PTLPQPELCAVDTAPGYVAGAHQFGLSQNSHLVLPLNQSDVRKRLQVQLSIRTFASSGLI
YYVAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMT
VDGQESPSVTVVGNATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEIMVNGQQLD
KDRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTTSKNGVLLGI
SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVLT
VDGNSVRAESPHTHSTSADTNDPIYVGGYPAHIKQNCLSSRASFRGCVRNLRLSRGSQVQ
SLDLSRAFDLQGVFPHSCPGPEP
NT seq 9252 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcagcggcacgggagccgcgctcctggtgctcctggcctcggtgctctgggtc
accgtgcggagccagcagagaggcttgttccctgccattctcaacctggccaccaatgcc
cacatcagcgccaatgctacctgtggagagaaggggcctgagatgttctgcaaactcgtg
gagcacgtgccgggccggcctgttcgacacgcccaatgccgggtctgtgacggtaacagt
acgaatcctagagagcgccatccgatatcacacgcaatcgatggcaccaacaactggtgg
cagagccccagtattcagaatgggagagagtatcactgggtcactgtcaccctggactta
cggcaggtctttcaagttgcatacatcatcattaaagctgccaatgcccctcggcctgga
aactggattttggagcgctccgtggatggcgtcaagttcaaaccctggcagtactatgcc
gtcagcgatacagagtgtttgacccgctacaaaataactccacggcggggacctcccact
tacagagcagacaacgaagtcatctgcacctcgtattattcaaagctggtgccacttgaa
catggagagattcacacatcactcatcaatggcagacccagcgctgacgacccctcaccc
cagttgctggaattcacctcagcacggtacattcgccttcgtctgcagcgcatcagaaca
ctcaacgcagacctcatgacccttagccatcgggacctcagagaccttgaccccattgtc
acaagacgttattactattcgataaaagacatttccgttggaggcatgtgcatttgctac
ggccatgccagcagctgcccgtgggatgaagaagcaaagcaactacagtgtcagtgtgaa
cacaatacgtgtggcgagagctgcgacaggtgctgtcctggctaccatcagcagccctgg
aggcccggaaccatttcctccggcaacgagtgtgaggaatgcaactgtcacaacaaagcc
aaagattgttactatgacagcagtgttgcaaaggagaggagaagcctgaacactgccggg
cagtacagtggaggaggggtttgtgtcaactgctcgcagaataccacagggatcaactgt
gaaacctgtatcgaccagtattacagacctcacaaggtatctccttatgatgaccaccct
tgccgtccctgtaactgtgaccctgtggggtctctgagttctgtctgtatcaaggatgac
cgccatgccgatttagccaatggaaagtggccaggtcagtgtccatgtaggaaaggttat
gctggagataaatgtgaccgctgccagtttggctaccggggtttcccaaattgcatcccc
tgtgactgcaggactgtcggcagcctgaatgaggatccatgcatagagccgtgtctttgt
aagaaaaatgttgagggtaagaactgtgatcgctgcaagccaggattctacaacttgaag
gaacgaaaccccgagggctgctccgagtgcttctgcttcggtgtctctggtgtctgtgac
agcctcacgtggtccattagtcaggtgaccaatatgtcagggtggctggtcactgacttg
atgagcacaaataagatccggtcccagcaagatgtcctgggtgggcaccgtcagatcagc
atcaacaacacggcggtcatgcagaggctgacttccacttactactgggcagctcctgag
gcctacctcggaaacaagctgacagcatttggcggtttcctgaaatacactgtgtcttac
gacattccagtggagacggtggacagtgacctcatgtctcatgctgacatcatcatcaag
gggaatgggctcaccataagcacaagagctgagggcctgtccttgcaaccctatgaggaa
tacttcaacgtggttagacttgtgcctgagaacttccgggactttgataccagaagggag
attgaccgtgaccagctgatgactgtcctggccaatgtgacacatctcttgatcagagcc
aattataattctgctaaaatggcgctctataggctggattctgtctctctggacatagca
agccctaatgctatagacttggcagtggctgctgatgtggaacactgtgaatgtccccaa
ggctacacggggacctcctgtgaggcctgcctccctggctattatcgagtagacgggata
ctctttggaggaatctgtcagccctgcgagtgccacgggcatgcatccgagtgtgacatt
catggaatttgctctgtgtgtacacacaacaccacgggggatcactgtgagcagtgcctg
cctggcttctatgggacaccttcacgtgggaccccaggagactgccagccttgtgcctgc
cctctctccattgactctaacaatttcagccctacctgccacctcactgatggagaggaa
gtggtttgtgaccagtgtgccccgggttactcaggatcctggtgtgagagatgtgcagat
ggttactatggaaacccaaccgtgccagggggaacctgtgtaccatgcaactgcagtggc
aatgttgatcccttggaggctggccactgtgactctgtcacaggggaatgcctgaagtgc
ttatggaacacagacggtgcccattgtgagaggtgtgcagatggcttctatggagatgcc
gtgactgccaaaaactgccgagcctgtgactgccacgagaatggctccctttctggcatc
tgccatctggagactggactgtgtgactgcaaacctcacgtgacaggacagcagtgtgac
cagtgcctgtctggctactacgggttggacacggggcttggctgtgtgccctgtaactgc
agtgtggaaggctctgtatctgacaactgcacggaggaaggacagtgtcactgtggacca
ggtgtctctgggaaacagtgtgacaggtgttcacacggtttctatgcattccaggatggc
ggctgcacaccctgtgactgtgctcatacccagaataactgtgaccccgcctctggagag
tgtctctgcccgcctcacacgcaggggctgaagtgtgaggagtgtgaagaggcatactgg
ggtctggacccggagcaggggtgccaggcttgcaattgcagtgctgtgggctccacgagt
gcccagtgtgatgttctctctggccactgcccctgcaaaaaagggtttggtgggcagagc
tgccatcagtgttccctaggctacagaagttttcctgactgtgtcccctgtggctgtgac
ctgagggggacactgcctgacacctgcgacctggaacagggtctctgcagctgctcagag
gacggtggtacctgctcctgcaaggagaatgccgtgggcccccagtgcagtaagtgccaa
gccggcacctttgccttgcgaggggacaaccctcaaggctgcagcccctgcttctgcttc
ggtctgtcgcagctctgctcagagttggagggttacgtgaggactctgataactctagcc
tccgatcagcccctcctgcatgtggtttcacagagcaacctcaagggcacaatcgaaggc
gtgcatttccagcctcctgacaccttgctggacgcagaggctgtccgccagcatatctat
gcagagccattttactggcggctaccaaagcagttccagggagaccagctcttggcttat
ggtgggaaactccagtacagtgtggctttctactctacacttggcaccggaacatccaat
tatgagcctcaagtcctcatcaaaggaggtcgggccaggaagcacgtcatttatatggat
gccccagcgcctgagaatggagtgagacaggattacgaagtgcggatgaaagaggaattc
tggaaatattttaactccgtgtctgagaaacatgtcacacactctgattttatgtctgtt
ctcagcaatattgactacatcctcatcaaagcatcatacggccagggactgcagcagagc
agaattgccaacatttccatggaggttggccggaaagctgtcgagctgcccgctgagggc
gaggcggcattgctgttggagctctgtgtctgtcctcctggcaccgcaggacactcctgt
caggactgtgctcctgggtactacagagaaaagctcccagaaagtggtggcaggggaccc
cgccctctgctggctccttgtgtgccctgcaattgcaacaaccacagtgatgtctgtgac
cccgaaactggaaagtgcctgagctgcagggaccacacatccggggaccactgtgagctg
tgtgcttctggctactatgggaaggtgactggactgcctggagactgtaccccgtgcacc
tgtcctcatcaccctcctttcagtttcagccccacttgtgtcgtggaaggtgacagtgat
ttccggtgcaatgcctgcctccccggctatgaaggacagtactgtgaaaggtgctctgca
ggctatcacggcaaccctcgagcagcaggtggtagctgccaaacgtgtgattgcaacccc
caaggctctgtccacagtgactgtgaccgtgcatccgggcagtgtgtctgcaagccagga
gctacagggctccactgtgagaaatgcctgccgagacacatcctgatggagagcgactgt
gtttcctgtgatgatgactgtgtgggtcctttgctgaacgacctggattctgttggtgat
gccgttctgtctctgaacctcacgggcgtttcccctgctccctatggaatcctggaaaat
ctggaaaatacaactaaatatttccagaggtatttaataaaggaaaatgccaagaagatt
cgagcagagatccagctcgaagggattgcagagcaaacagaaaatctgcaaaaggagctc
accagagtgttagcacgccatcagaaggtgaacgctgaaatggaaagaacttccaatggg
actcaagccctggccacgttcattgagcagctacatgcaaacatcaaagaaatcacagaa
aaggtggcaacgttgaaccagacggcgcgtaaagatttccagccacccgtgtctgccctt
cagagcatgcaccagaacatttcgtctctgctgggactcatcaaggaaaggaatttcaca
gagatgcagcagaatgctacccttgagctcaaggctgctaaagacttattgtcacggatt
cagaaaaggtttcagaagcctcaggaaaagttgaaggcattgaaggaggccaacagcctc
ctttccaaccacagtgaaaaactgcaggctgctgaggagctccttaaggaagctggaagc
aagacccaggagagcaacctcctgctgctccttgtcaaggccaacctgaaagaattccag
gagaaaaagctgcgtgttcaagaagaacaaaatgtgacctcagagctcattgccaagggt
agagaatgggtggatgctgccgggactcacacagctgctgcacaagacaccctaacacag
ctggagcatcaccgagatgaactccttctgtgggccagaaaaatcaggagccacgtagat
gacctcgtcatgcagatgtccaaacgaagagcccgtgacctggtccacagggcagagcag
catgcctctgagctgcagagcagggcaggagctttggacagagaccttgaaaatgttaga
aacgtgtctttgaatgccaccagtgcggcacacgtccacagcaacatccagacactgaca
gaggaagctgagatgctggctgctgatgctcacaagacggcgaataagacagacttgatc
tccgaatccctggcttctcgggggaaagcagtccttcagcgctcgtcccggtttctaaag
gaaagtgtcagtaccaggaggaagcagcaaggcattacgatgaagctggatgagttgaaa
aacttaacaagtcaatttcaggagagcatggataacattatgaagcaggccaacgactcc
cttgcgatgcttagagaaagccctggaggtatgagagagaagggcaggaaagccagagag
ctggcggcagcagccaacgagagtgcggtgaagacactggaggatgtgctggctttgagc
ctgagggtcttcaatacatcagaggacctgtccagagtgaatgccacagtccaggagaca
aacgaccttctgcataactccacgatgaccactctgttggctggaagaaaaatgaaagac
atggaaatgcaagccaaccttttattggatcgattgaaacctttgaaaaccctggaggag
aacctgagcagaaacctgtcggagatcaagctgctgatcagccgggcccggaaacaagtg
gcgtcgatcaaagtcgccgtgtctgcagacagagactgcatccgcgcctatcagcctcag
acttcatctaccaattacaacaccttgatcctgaacgtgaagacgcaggagcccgacaac
ctcctcttctacctcggcagcagcagcagttctgactttctcgcagtggagatgcggcgg
gggaaggtcgcctttctctgggacctgggctccgggtccacaaggttggaattcccagag
gtctccatcaataacaacagatggcacagcatctacataaccaggtttggaaacatgggg
tccctgagtgtaaaggaagcaagcgctgccgagaacccaccggtcaggacaagcaaatct
cctggaccgtcgaaggttctggacataaacaattcaacgctgatgtttgttggagggctc
ggaggtcagatcaagaaatccccggctgtgaaggttactcattttaagggctgcatggga
gaggccttcttgaatggcaaatcgattggcctgtggaattacatcgagagagaggggaag
tgcaatggctgctttggaagctcccagaacgaagattcctccttccatttcgatggaagc
gggtacgccatggtggagaagacgctccggcccaccgtgacgcagatagtaattctcttc
agcaccttctccccgaatggccttcttttctacctggcttcaaacggcaccaaggacttc
ctatccatcgagctggtccgtggcagggtcaaagtgatggtggacctagggtcaggaccc
ctcactcttatgacagacaggcggtataacaacggaacctggtataaaatcgccttccag
cggaaccggaagcaaggactgctagctgtcttcgatgcatatgacaccagtgacaaggag
acaaagcaaggagagactccaggagccgcttccgacctcaatcggctggagaaagacctg
atttacgtgggtggattgcctcattctaaggctgtgaggaaaggggtcagcagcagaagc
tatgtgggctgtatcaagaacctagagatatccaggtccacctttgatttgctgagaaat
tcctacggagtgagaaaaggctgcgcactggagcctatccagagtgtgagtttcctgaga
ggcggctatgtggagatgccacccaagtctctctcacctgagtcatccctgctggccaca
ttcgccaccaagaacagcagcggaatcctcctggttgccctgggcaaggatgcggaggag
gctggtggggctcaggcacatgtgcccttcttttccatcatgctgcttgagggacgaatt
gaagtgcatgtcaactctggggacgggaccagtctgaggaaggccctcctgcatgccccc
accggctcctacagtgatggacaggaacactccatctccctggttaggaatcggagagtt
atcaccatacaagtggatgagaacagtcccgtagaaatgaagttgggtccattaacagaa
ggaaagacgatcgacatatccaacctgtacatagggggacttccggaggacaaggcgacc
ccgatgctcaagatgcggacttcgttccatgggtgtattaaaaacgtggtccttgacgct
caacttttggacttcacccatgcgactggctctgagcaagtagagctggacacatgcttg
ctggcagaagagcccatgcagagtctgcacagagaacacggggaactccctccggagccc
ccaactctaccacagcctgaactgtgcgcagtagacacggctccggggtatgtggcaggt
gctcaccagtttggcctctcgcagaacagccacttggtgctccctctgaatcagtctgat
gtccggaagaggctccaggtgcagctgagcattcggacatttgcctccagtggcctcatt
tactatgtggctcatcagaaccaaatggactacgccacgctccagctccaagagggccgc
ctgcacttcatgtttgatctcggcaagggccggaccaaggtctcccaccctgccctgctc
agtgatggcaagtggcacacagtcaagacagaatacattaaaaggaaggcgttcatgact
gttgacggccaagagtcccccagtgtgactgtggtgggcaatgcaaccacgctggatgtg
gaaaggaaactgtacctcggaggccttcccagccactacagggccaggaacatcgggact
atcacccacagcatccctgcctgcattggggaaatcatggttaatggccaacagctggat
aaagacaggcccttgtctgcctctgctgtggacaggtgctatgtcgtggctcaggaagga
actttctttgaaggaagcggatatgcagctcttgtcaaggaaggttacaaagttcgattg
gatttaaatatcacactggagttccgtactacctctaagaatggcgtcctcctgggaatc
agcagtgccaaagtggatgccattggcctagagattgtagatggcaaggtcttatttcac
gtcaacaacggtgccggaaggataacagccacctaccagcccagagccgccagagctctc
tgtgatggcaagtggcacacactccaagcccacaaaagcaagcaccgcatcgtcctgact
gtggacgggaattccgttagggctgaaagcccccacacccattccacctcggcagacacc
aacgatcccatttatgtgggtggctatcctgcccacatcaaacagaactgcctgagcagc
cgggcctcattccggggctgtgtgaggaacctcaggctgagcaggggctcacaagtgcag
tccttggacctgagccgagcctttgacctacaaggagtcttccctcattcctgccccggg
cctgagccctaa

KEGG   Mus musculus (mouse): 16773Help
Entry
16773             CDS       T01002                                 

Gene name
Lama2, 5830440B04, dy, mKIAA4087, mer, merosin
Definition
(RefSeq) laminin, alpha 2
  KO
K05637  laminin, alpha 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16773 (Lama2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16773 (Lama2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16773 (Lama2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16773 (Lama2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16773 (Lama2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16773 (Lama2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16773 (Lama2)
   05414 Dilated cardiomyopathy (DCM)
    16773 (Lama2)
   05416 Viral myocarditis
    16773 (Lama2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16773 (Lama2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16773 (Lama2)
   05145 Toxoplasmosis
    16773 (Lama2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 Arfaptin DUF948 Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 16773
NCBI-ProteinID: NP_032507
MGI: 99912
Ensembl: ENSMUSG00000019899
Vega: OTTMUSG00000045038
UniProt: Q60675 Q5DTP0
LinkDB All DBs
Structure
PDB: 

Position
10 A4; 10 14.23 cM
AA seq 3118 aa AA seqDB search
MPAATAGILLLLLLGTLEGSQTQRRQSQAHQQRGLFPAVLNLASNALITTNATCGEKGPE
MYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGVEYHYV
TITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYP
RTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLR
FQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNK
SRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNL
SLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSE
VCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGSTNEDPCVG
PCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWY
LTDLSGRIRMAPQLDNPDSPQQISISNSEARKSLLDGYYWSAPPPYLGNRLPAVGGQLSF
TISYDLEEEEDDTEKILQLMIIFEGNDLRISTAYKEVYLEPSEEHIEEVSLKEEAFTIHG
TNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVC
QCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPY
CNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRC
ERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADG
YFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRGC
LPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCD
PKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPK
FSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH
CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSEAKGLIRTWVTLSDEQTILPLVDEALQH
TTTKGIAFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE
TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTV
TREDFLDILYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVLAGSPPAHLIERCDCPP
GYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTA
GDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQ
YCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWH
AREGAECVFCGDECTGLLLGDLARLEQMTMNINLTGPLPAPYKILYGLENTTQELKHLLS
PQRAPERLIQLAEGNVNTLVMETNELLTRATKVTADGEQTGQDAERTNSRAESLEEFIKG
LVQDAEAINEKAVQLNETLGNQDKTAERNLEELQKEIDRMLKELRSKDLQTQKEVAEDEL
VAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDANRLS
AANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLP
PMSEELSDKIDDLAQEIKDRRLAEKVFQAESHAAQLNDSSAVLDGILDEAKNISFNATAA
FRAYSNIKDYIDEAEKVAREAKELAQGATKLATSPQGLLKEDAKGSLQKSFRILNEAKKL
ANDVKGNHNDLNDLKTRLETADLRNSGLLGALNDTMDKLSAITNDTAAKLQAVKEKAREA
NDTAKAVLAQVKDLHQNLDGLKQNYNKLADSVAKTNAVVKDPSKNKIIADAGTSVRNLEQ
EADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCVRTYRPEIKK
GSYNNIVVHVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTI
DDSYWYRIEASRTGRNGSISVRALDGPKASMVPSTYHSVSPPGYTILDVDANAMLFVGGL
TGKIKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFD
GEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELSDGHVKVSYDL
GSGMTSVVSNQNHNDGKWKAFTLSRIQKQANISIVDIDSNQEENVATSSSGNNFGLDLKA
DDKIYFGGLPTLRNLSMKARPEVNVKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLE
NVYTVSFPKPGFVELAAVSIDVGTEINLSFSTRNESGIILLGSGGTLTPPRRKRRQTTQA
YYAIFLNKGRLEVHLSSGTRTMRKIVIKPEPNLFHDGREHSVHVERTRGIFTVQIDEDRR
HMQNLTEEQPIEVKKLFVGGAPPEFQPSPLRNIPAFQGCVWNLVINSIPMDFAQPIAFKN
ADIGRCTYQKPREDESEAVPAEVIVQPQPVPTPAFPFPAPTMVHGPCVAESEPALLTGSK
QFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPY
FSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGI
LYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYF
DGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNG
AGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPV
FVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
NT seq 9357 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcggccaccgccgggatcctcttgctcctgctcttggggacgctcgaaggctcc
cagactcagcggcgacagtcccaagcgcatcaacagagaggtttatttcctgctgtcctg
aatcttgcttcgaatgcactcatcacaaccaatgctacatgtggggaaaaaggacccgag
atgtactgcaagttggtggaacatgtccccgggcagcctgtgaggaaccctcagtgccga
atctgcaatcagaacagcagcaatccataccagaggcacccgattacgaatgctattgat
ggcaagaacacatggtggcagagtcccagtatcaagaatggagtggaataccattatgtg
acaattactctggatttacagcaggtgttccagattgcctacgtaattgtgaaggcagcc
aattcccctcggcctggaaactggattttggaacgttccctggatgacgtggagtacaaa
ccctggcagtatcatgcggtgacagacacggagtgcctgaccctctacaatatctatccc
cgcactggaccaccatcctacgccaaagatgatgaggtcatctgcacttcattttattcg
aagatccaccctttagaaaatggagagattcacatttctttgatcaatgggagaccaagt
gctgatgacccctcccctgaactcctggaattcacctctgctcgctacattcgcctgaga
tttcagaggatccgcaccttgaatgcagacttgatgatgtttgctcacaaagaccccaga
gaaatcgatcccattgtcacacgaagatattactattctgtcaaggatatttcagttggc
gggatgtgcatctgttatggtcatgcccgggcttgtccacttgaccctgcaacaaataaa
tcacgctgtgagtgtgaacataacacctgtggggaaagctgtgacaggtgctgtccagga
ttccatcagaagccttggagagctggaaccttcctcaccaagtctgagtgtgaagcatgc
aattgtcacggaaaagctgaggaatgctattatgatgaaactgttgctagcagaaatcta
agtttaaatatacatgggaagtacatcggagggggtgtgtgcatcaactgcacacataac
acggctgggataaattgtgagacatgtgttgatggattcttcagaccaaaaggggtatca
ccaaattatccaagaccatgccagccatgtcactgtgatccaactggctcccttagtgaa
gtctgtgtcaaagatgagaaatatgcccagcgagggttgaaacctggatcctgtcactgc
aaaactggctttggaggcgtgaactgtgatcgctgtgtcaggggttaccatggttaccca
gactgccaaccctgtaactgtagtggcttggggagcacaaacgaggacccttgcgttggg
ccctgtagctgtaaggagaatgttgaaggtgaagactgtagtcgttgcaaatctggtttc
ttcaacttgcaagaagataatcagaaaggctgtgaggagtgtttctgttcaggagtatca
aacagatgtcagagttcctactggacctatgggaatattcaagacatgcgtggttggtat
ctcacagacctctctggccgcattcggatggctccccagcttgataaccctgactcacct
cagcagatcagcatcagtaactctgaggcccggaaatccctgcttgatggttactactgg
agtgcaccgcctccatatctgggaaacagacttccagctgttggaggacagttgtcattt
accatctcatatgacctcgaagaagaggaagacgatacagaaaaaatccttcagctgatg
attatctttgagggaaatgacttaagaatcagcacagcgtataaggaggtgtacttagag
ccatctgaagaacacattgaggaggtgtcactcaaagaagaggcctttactatacatgga
acaaatttgccagtcactagaaaagatttcatgattgttctcacaaatttggagagagtc
cttatgcaaatcacatacaacttagggatggacgccatcttcaggctgagttctgtcaat
cttgaatctgctgtcccttatcctactgatagacgtattgcaactgatgtggaagtttgc
cagtgtccacctgggtacagtggcagctcttgtgaaacatgttggcctaggcaccgaaga
gttaacggcaccatttttggtggcatttgtgaaccatgtcagtgctttgctcatgcagaa
gcctgtgatgacatcacaggagaatgtctgaactgtaaggatcacacaggtgggccgtac
tgcaatgaatgtctccctggtttctatggtgatcctactcgaggaagccctgaagactgt
cagccctgtgcctgtccactcaatatcccatcaaataactttagtccaacatgccattta
gaccggagtctgggattgatctgtgacgagtgtcctattgggtacacaggaccgcgctgt
gagaggtgtgcagaaggctattttggacaaccttccatacctggaggatcatgtcagcca
tgccaatgcaatgacaaccttgactactccatccctggcagctgtgacagcctgtctggc
tcctgtctgatttgtaagccaggtacaacaggccggtactgtgagctctgtgctgatggg
tattttggagacgcggttaatgcaaagaactgtcaaccatgccgttgtaatatcaatggc
tccttctcagagatttgtcacactagaactgggcaatgtgagtgcagacccaatgtgcag
gggcggcactgtgacgagtgtaagcctgaaacctttggcctgcaactgggaaggggttgt
ctgccctgcaactgcaattcttttgggtctaagtcctttgactgtgaagcaagtgggcag
tgctggtgccagcctggagtagcagggaagaaatgtgaccgttgtgcccatggctacttc
aacttccaagaaggaggctgcatagcttgtgactgttctcatctgggcaacaactgtgac
ccaaaaactggccaatgcatttgcccacccaataccactggagaaaagtgttctgagtgt
cttcccaacacctggggtcacagcattgtcaccggctgtaaggtttgtaactgcagcact
gtggggtccttggcttctcagtgcaatgtaaacacgggccagtgcagctgtcatccaaaa
ttctctggtatgaaatgctcagagtgcagccgaggtcactggaactatcctctctgcact
ctatgtgactgcttccttccagggacagatgccacgacttgtgatctggagactaggaaa
tgctcctgtagtgatcaaactggacagtgcagctgtaaggtgaatgtggaaggcgtccac
tgtgacaggtgccggcctggcaaatttggactagatgccaagaacccacttggctgcagc
agctgctactgctttggagttactagtcaatgctctgaagcaaaggggctgatccgtacg
tgggtgactttgagtgatgaacagaccattctacctctggtggatgaggccctgcagcac
acgactaccaaaggcattgctttccagaaaccagagattgttgcaaagatggatgaagtc
aggcaagagctccatttggaacctttttactggaaactcccacaacaatttgaagggaaa
aagttgatggcttatggtggcaaactcaagtatgccatctattttgaggctcgggatgag
acaggctttgccacatataaacctcaagttatcattcgaggtggaactcctactcatgct
agaattattaccagacacatggctgcccctctcattggccagttgacacggcatgaaata
gaaatgacagagaaagaatggaaatattatggtgatgatcctcgaatcagtagaactgtg
acccgtgaagacttcttggatatactatatgatattcactatatccttatcaaggctact
tatggaaacgttgtgagacaaagccgcatttctgaaatctccatggaagtagccgaacca
ggacatgtattagcagggagcccaccagcacacttgatagaaagatgcgattgccctcct
ggctattctggcttgtcttgtgagacgtgtgcaccaggattttatcgacttcgttctgaa
ccaggtggccgcactcctggaccaaccttaggaacctgtgttccctgccaatgtaatgga
cacagcagtcagtgtgatcctgagacctcagtatgccagaattgtcagcatcacactgct
ggtgacttctgtgagcgctgtgcccttggctactatggaatcgtcaggggattgccaaat
gactgtcaaccatgtgcttgtcctctgatttcgcccagcaacaatttcagcccctcttgt
gtattggaaggtctggaagattaccgttgcaccgcctgcccaaggggctatgaaggacag
tactgtgaaaggtgtgccccaggctatactggcagcccaagcagccccggaggctcctgc
caagaatgtgagtgtgacccttatggctccctaccggttccctgtgaccgggtcacggga
ctctgcacgtgccgccctggagccacaggaaggaagtgtgatggctgcgagcactggcat
gcacgcgagggtgcagagtgtgtcttttgtggagacgagtgtacaggccttcttcttggt
gacctggctcgtctagagcagatgaccatgaacatcaacctcacgggcccactgcctgct
ccatataaaattctgtatggtcttgaaaatacaactcaggaactcaagcacctgctatca
ccgcaacgggcaccagagaggctcattcagttggcagagggcaacgtgaacacacttgtg
atggaaacaaatgagctgctaaccagagcaaccaaagtgacagcagatggtgagcaaaca
ggacaagatgctgagaggaccaactccagagcagaatccttggaagaattcattaaaggg
cttgtccaggatgctgaagccataaatgaaaaagctgtacaactaaatgaaaccttagga
aatcaagataagacagcagagagaaacttggaggagcttcaaaaggaaatcgaccggatg
ctgaaggaactgagaagtaaagatcttcaaacacagaaggaagttgctgaggatgagctc
gtggcagcagaaggccttctgaagagagtaaacaagctgtttggagagcccagagcccag
aatgaagatatggaaaaggatctccagcagaaactggcagagtacaagaacaaacttgat
gatgcttgggatctattgagagaagccactgataaaactcgagatgctaatcgtttgtct
gctgccaatcaaaaaaacatgaccatactggagacaaagaaggaggctattgaaggtagc
aaacgacaaatagagaacactttaaaggaaggcaatgacatccttgatgaagccaatcga
ctcttaggtgaaatcaactcagtcatagattatgtcgacgacattaaaactaagttgcca
ccaatgtccgaggagctgagtgacaaaatagatgacctcgcccaggaaataaaggacaga
aggcttgctgagaaggtgttccaggctgagagccatgctgctcagctgaacgactcgtct
gctgtacttgatggaatcctggatgaggctaagaacatctctttcaatgccacggcagcc
ttcagagcttacagtaatattaaagactacattgatgaagctgagaaagtggccagagaa
gccaaagagcttgcccaaggggctacaaaactggcaacaagtcctcagggcttattaaaa
gaagatgccaaaggctcccttcagaaaagcttcaggatcctcaatgaagccaagaagcta
gcaaacgatgtgaaaggaaatcacaatgatctaaatgacctgaaaaccaggttagaaact
gctgaccttagaaacagtggacttctaggagctctaaatgacaccatggacaagttatca
gccattacaaatgacacggctgctaaactgcaggctgtcaaagagaaagccagagaagcc
aatgacacagcaaaagctgtcctggcccaggttaaggacctgcatcagaacctagatggc
ctgaagcaaaactacaataaactggcagacagcgtggccaaaacgaacgctgtggtgaaa
gatccttccaaaaacaaaatcattgcagatgcaggcacttccgtgagaaatctagaacag
gaagctgaccggctaatcgacaaactcaagcccatcaaggagcttgaggacaacctaaag
aaaaacatttctgaaataaaggaactgatcaaccaagctcggaaacaagctaactctatc
aaagtatctgtttcttcgggaggtgactgtgttcgaacatacaggccagaaatcaagaaa
ggaagctacaataacatcgttgtccatgtcaagaccgctgttgccgacaacctccttttt
tatcttggaagtgccaaatttattgactttcttgctatagaaatgcgcaaaggcaaagtc
agcttcctctgggatgttggctctggagttggccgagtagagtatccagacttgaccatc
gacgactcctattggtaccgtattgaagcatcaagaacgggaagaaatggatctatttct
gtgagagctttagatggacccaaagccagtatggtacccagcacctaccattcagtgtct
cctcccgggtacactatcctagatgtggatgcaaatgcaatgctgtttgttggtggcctg
accggaaaaataaagaaggccgatgctgtacgtgtgatcaccttcaccggctgtatggga
gaaacatactttgacaacaaacctataggtttatggaacttccgggagaaagaaggcgac
tgtaagggatgtactgtcagcccacaagtggaagatagtgaggggactattcagtttgat
ggtgaaggctatgcattagtgagccgccctatccgctggtaccccaacatctccacagtc
atgttcaagttccggacattttcatcaagtgctctcctgatgtatcttgccacacgagac
ctgaaagatttcatgagtgtagagctcagtgatggacatgtgaaagtcagctatgacctg
ggctcaggaatgacttccgttgtcagcaatcaaaaccataatgatgggaaatggaaagca
ttcacgctgtcgcggattcagaaacaagccaacatatcgattgtcgacatcgattctaac
caggaggagaatgtagctacttcatcttctggaaacaactttggtcttgacttgaaagca
gatgacaaaatatattttggtggcctgccaactctgagaaacttgagtatgaaagcaagg
ccagaagtcaatgtgaagaaatactccggctgcctcaaagatattgaaatttcaagaaca
ccttacaatatactcagcagccctgattatgttggtgtgaccaaaggctgttcactggag
aatgtttatacagttagtttccccaagcctggttttgtggagcttgccgctgtgtctatt
gatgttggaacagaaatcaatctgtcctttagtaccaggaacgagtctgggatcattctc
ttgggaagtggagggacactcacaccacccaggagaaaacggagacaaaccacacaggct
tattatgccatattcctcaacaagggccgcttggaagtgcatctctcctcggggacacgg
acaatgaggaaaattgtcatcaaaccggagccaaatttgtttcatgatgggagagaacat
tctgtccacgtagaaagaaccagaggcatcttcactgttcaaattgatgaagacagaaga
catatgcaaaacctgacagaggaacagcccatcgaagtgaaaaagctctttgtcgggggt
gctcctcctgaatttcagccctccccactcaggaatattccggcctttcaaggctgtgtg
tggaaccttgttattaactccatccccatggactttgcgcagcctatagccttcaaaaat
gccgacattggccgctgtacctatcaaaagccccgggaagatgagagtgaagcagttcca
gctgaagttattgtccagcctcagccggtgcccacccctgccttccctttcccggccccc
accatggtgcatggcccttgtgttgcagaatcagaaccagctcttctgacagggagcaag
cagtttgggctttccagaaacagccacattgcaattgcttttgatgacaccaaagttaaa
aatcgcctcaccattgagctggaggtacgaactgaagctgaatcaggcttgctcttctac
atggctcggatcaatcatgctgattttgctactgttcagctgaggaatggcttcccgtac
ttcagttatgatttggggagtggggacacaagcaccatgatccccacaaaaatcaacgat
ggccagtggcacaagattaagattgtgagagtgaagcaggagggaattctttatgtggat
gatgcctccagccaaaccatcagtcccaagaaagctgacatcctggatgtcgtggggatt
ctgtatgtcggtggattgccgatcaactataccacacgcagaattggtccagtgacttac
agcctggatggctgtgttaggaatcttcacatggaacaagcccctgttgatctggaccag
cctacctccagctttcacgttgggacatgctttgcgaatgcagagagtgggacttacttt
gatggaaccggttttgctaaagcagttggtgggttcaaagttggattggaccttcttgtg
gaatttgaattccgtaccacaagacccactggggtcctcctgggagtcagcagtcagaag
atggatggaatgggtattgaaatgatcgacgagaagcttatgttccacgtggataatggc
gctggccgattcactgcaatctatgatgctgggatcccaggccacatgtgcaatggacag
tggcataaagtcactgccaagaagatcaaaaaccgtcttgagctggtggtagatgggaac
caggtggatgcccagagcccaaactcagcatcgacatcagctgatacaaacgaccctgtt
tttgttggcggtttcccaggtggcctcaatcagtttggcctgaccaccaacattaggttc
cgaggctgcatccgatctctgaagctcaccaaaggcactggcaaaccgctggaggttaat
tttgccaaggccctggaactgaggggtgttcaacctgtatcatgcccgactacctaa

KEGG   Mus musculus (mouse): 16774Help
Entry
16774             CDS       T01002                                 

Gene name
Lama3, Lama3B, [a]3B
Definition
(RefSeq) laminin, alpha 3
  KO
K06240  laminin, alpha 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16774 (Lama3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16774 (Lama3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16774 (Lama3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16774 (Lama3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16774 (Lama3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16774 (Lama3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16774 (Lama3)
   05145 Toxoplasmosis
    16774 (Lama3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_I Laminin_G_2 Laminin_N Laminin_G_1 Laminin_II Laminin_B Laminin_G_3 RNase_E_G
Motif
Other DBs
NCBI-GeneID: 16774
NCBI-ProteinID: NP_034810
MGI: 99909
Ensembl: ENSMUSG00000024421
Vega: OTTMUSG00000045059
UniProt: Q61789
LinkDB All DBs
Position
18 A1; 18 6.2 cM
AA seq 3330 aa AA seqDB search
MAVALGRAPRSLPLLLTLLLLLLLRMSPSWSVVGQDHPMSSRSLHPPYFNLAQAARIWAT
ATCGERDPEVSRPRPELFCKLVGGPAAQGSGHTIQGQFCDYCNSEDSRKAHPASHAIDGS
ERWWQSPPLSSGTQYNQVNLTLDLGQLFHVAYILIKFANSPRPDLWILERSVDFGSTYSP
WQYFAHSRRDCVEQFGQEANMAITQDDQMLCVTEYSRIVPLENGEIVVSLINGRPGAKKF
AFSDTLREFTKATNIRLRFLRTNTLLGHLISKAERDPTVTRRYYYSIKDISVGGRCVCNG
HAEACSADNPEKQFRCECQHHTCGDTCNRCCAGYNQRRWQPAGQEQHNECEACNCHGHAV
DCYYDPDVEHQQASLNSKGVYAGGGVCINCQHNTAGVNCEKCAKGYFRPHGVPVDALHGC
IPCSCDPERADDCDQGSGHCHCKPNFSGDYCETCADGYYNFPFCLRIPVFPNYTPSPEDP
VAGNIKGCDCNLEGVLPEICDDRGRCLCRPGVEGPQCDSCRSGSYSFPICQACQCSTIGS
YPVPCDPGNGQCDCLPGITGRQCDRCLSGAYDFPYCQGSGSVCHPAGTLDSSLGYCQCKQ
HVASPTCSVCKPLYWNLAKENPRGCSECQCHEAGTLSGIGECGQEDGDCSCKAHVTGDAC
DTCEDGFFSLEKSNYFGCQGCQCDIGGALTTMCSGPSGVCQCREHVEGKQCQRPENNYYF
PDLHHMKYEVEDGTGPNGRNLRFGFDPLVFPEFSWRGYAPMTSVQNEVRVRLSVRQSSLS
LFRIVLRYISPGTEAISGRITLYSSQGDSDALQSRKITFPPSKEPAFVTVPGNGFAGPFS
ITPGTWIACIQVEGVLLDYLVLLPRDYYEAFTLQVPVTEPCAHTGSPQDNCLLYQHLPLT
AFSCTLACEARHFLLDGELRPLAMRQPTPTHPAMVDLSGREVELQLRLRVPQVGHYVVLL
EYATEVEQLFVVDVNLKSSGSALAGQVNIYSCKYSIPCRSVVIDSLSRTAVHELLADADI
QLKAHMAHFLLYHICIIPAEEFSTEYLRPQVHCIASYRQHANPSASCVSLAHETPPTASI
LDATSRGLFSALPHEPSSPADGVTLKAPQSQVTLKGLIPHLGRHVFVIHFYQAEHPGFPT
EVIVNGGRQWSGSFLASFCPHLLGCRDQVISDGQVEFDISEAEVAVTVKIPDGKSLTLVR
VLVVPAENYDYQILHKTTVDKSSEFISSCGGDSFYIDPQAASGFCKNSARSLVAFYHNGA
IPCECDPAGTAGHHCSPEGGQCPCRPNVIGRQCSRCATGYYGFPYCKPCNCGRRLCEEVT
GKCLCPPHTVRPQCEVCEMNSFNFHPVAGCDVCNCSRKGTIEAAVSECDRDSGQCRCKPR
VTGQQCDKCAPGFYQFPECVPCSCNRDGTEPSVCDPETGACMCKENVEGPQCQLCREGSF
YLDPTNPKGCTKCFCFGVNTDCQSSHKQRAKFVDMMGWRLETADGVDVPVSFNPGSNSMV
ADLQELPPSVHSASWVAPPSYLGDKVSSYGGYLTYHAKSFGLPGDMVLLGKQPDVQLTGQ
HMSLIHKEPSDPRPDRLHHGRVQVIEGNFRHEGSSAPVSREELMTVLSRLERLHIRGLHF
TETQRLTLGEVGLEEASDTGSGPRAHLVEMCACPPDYTGDSCQGCRPGYYWDNKSLPVGR
CVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCQAGHYGNAIHGSCRVCPCPHTNSFA
TGCAVDGGAVRCACKPGYTGTQCERCAPGYFGNPQKFGGSCQPCNCNSNGQLGPCDPLTG
DCVNQEPKDGSPAEECDDCDSCVMTLLNDLASMGEELRLVKSKLQGLSVSTGALEQIRHM
ETQAKDLRNQLLGFRSATSSHGSKMDDLEKELSHLNREFETLQEKAQVNSRKAQTLYNNI
DQTIQSAKELDMKIKNIVQNVHILLKQMARPGGEGTDLPVGDWSRELAEAQRMMRDLRSR
DFKKHLQEAEAEKMEAQLLLHRIRTWLESHQVENNGLLKNIRDSLNDYEDKLQDLRSILQ
EAAAQAKQATGINHENEGVLGAIQRQMKEMDSLKNDFTKYLATADSSLLQTNNLLQQMDK
SQKEYESLAAALNGARQELSDRVRELSRSGGKAPLVVEAEKHAQSLQELAKQLEEIKRNT
SGDELVRCAVDAATAYENILNAIRAAEDAASKATSASKSAFQTVIKEDLPKRAKTLSSDS
EELLNEAKMTQKRLQQVSPALNSLQQTLKTVSVQKDLLDANLTVARDDLHGIQRGDIDSV
VIGAKSMVREANGITSEVLDGLNPIQTDLGRIKDSYESARREDFSKALVDANNSVKKLTR
KLPDLFIKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAIPMRFNGKSGVEVRLP
NDLEDLKGYTSLSLFLQRPDLRENGGTEDMFVMYLGNKDASKDYIGMAVVDGQLTCVYNL
GDREAEVQIDQVLTESESQEAVMDRVKFQRIYQFAKLNYTKEATSTKPKAPGVYDMESAS
SNTLLNLDPENAVFYVGGYPPGFELPRRLRFPPYKGCIELDDLNENVLSLYNFKTTFNLN
TTEVEPCRRRKEESDKNYFEGTGYARIPTQPNAPFPNFMQTIQTTVDRGLLFFAENQDNF
ISLNIEDGNLMVKYKLNSEPPKEKGIRDTINNGRDHMILISIGKSQKRMLINMNKHSIII
EGEIFDFSTYYLGGIPIAIRERFNISTPAFQGCMKNLKKTSGVVRLNDTVGVTKKCSEDW
KLVRTASFSRGGQMSFTNLDVPSLDRFQLSFGFQTFQPSGTLLNHQTRTSSLLVTLEDGH
IALSTRDSSSPIFKSPGTYMDGLLHHVSVISDTSGLRLLIDDQVLRRNQRLASFSNAQQS
LSMGGGYFEGCISNVFVQRMSQSPEVLDMASKSTKRDAFLGGCSLNKPPFLMLFKSPKGF
NKARSFNVNQLLQDAPQAARSIEAWQDGKSCLPPLNTKATHRALQFGDSPTSHLLFKLPQ
ELLKPRLQFSLDIQTTSSRGLVFHTGTRDSFVALYLSEGHVIFALGAGGKKLRLRSKERY
HDGKWHSVVFGLSGRKVHLVVDGLRAQEGSLPGNSTISPREQVYLGLSPSRKSKSLPQHS
FVGCLRNFQLDSKPLDSPSARSGVSPCLGGSLEKGIYFSQGGGHVVLANSVSLEPALTLT
LSIRPRSLTGVLIHIASQSGEHLSVYMEAGKVTTSMNSEAGGTVTSITPKRSLCDGQWHS
VTVSIKQHTLHLELDTDNSYTAGQLSFPPNSTRGSLHIGGVPDKLKMLTLPVWNSFFGCL
KNIQVNHIPVPITEATDVQGSVSLNGCPDH
NT seq 9993 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggctctgggcagggcaccgcgatccttaccgctgctgctcactctattgctg
ctgctgttgctgaggatgtcgcccagctggagcgtggtgggtcaggaccatcccatgtcc
tcgcgcagcctgcacccgccctacttcaacctggcccaggcggcgagaatctgggccacc
gccacctgcggggagcgggacccagaggtctcaaggccccggcctgagcttttctgcaaa
ttggtgggcggccccgctgcacagggcagcggccacaccatccagggccagttctgtgac
tactgcaattctgaggattccaggaaggcacatccagccagccatgcaattgatggatcg
gaacggtggtggcaaagcccacctctctcctccggcacacagtacaatcaagtcaacctc
accttggatctgggtcagctcttccatgtggcttatatcttaatcaaatttgcaaactct
ccccgccctgatctttggatcctggaaagatctgtagactttggaagcacctactcacca
tggcagtattttgctcattctagaagagattgtgtagaacagtttgggcaagaagcaaac
atggcaattacccaggacgaccagatgctctgtgtcacggagtattcccgtatcgtgcct
ctggaaaatggcgagattgttgtatccttgataaatggtcgtccaggtgcaaaaaagttt
gctttctctgacactctgagggagtttactaaggcaacaaacatccgcttgcggtttctg
cgaaccaacaccctcctcgggcatcttatttccaaggcagagcgagaccccactgtcacg
cgccggtattattacagcataaaggatatcagtgttggtgggcggtgtgtttgcaacggc
catgcggaggcgtgcagtgctgacaaccctgaaaagcagttccgatgcgaatgccagcac
catacctgtggagacacgtgtaaccgctgctgtgcaggttacaatcagaggcgctggcag
cctgctggtcaggagcagcacaatgagtgtgaagcctgcaactgccatgggcatgctgtg
gactgctactatgacccagacgtggagcaccagcaggcgagcttgaacagcaaaggcgtc
tacgcaggtggaggggtctgcatcaactgtcagcacaacactgcaggcgtgaactgtgaa
aagtgtgcgaagggttacttccggccccatggagttccggtggatgcactgcatggatgc
atcccttgcagctgtgacccagaacgcgcagatgactgtgaccagggctcaggccactgc
cattgtaagccaaatttctccggagactactgtgagacgtgtgcagatgggtactataat
tttccattttgcttgagaattccagtctttcccaactacactccaagtccagaagatcca
gtggctggcaatataaaagggtgtgactgtaacttggaaggtgttctcccagagatatgt
gacgatcgtggcaggtgcctgtgccgccctggggttgagggtccccagtgtgactcctgc
cgctcgggctcctattcatttcccatatgccaagcttgccagtgttcgacgattggatcc
tatccagtgccctgtgacccggggaatggccagtgtgactgcctgcctggaattaccggg
aggcagtgtgacaggtgtctctcgggagcctatgactttccatactgccaagggtccggc
agtgtttgccatccagctgggacccttgactccagcctgggttattgtcagtgcaagcag
catgttgcaagtcctacatgtagtgtctgcaaaccattatattggaatctggccaaagaa
aacccccgtggatgctcagagtgccagtgccatgaagcagggacattgagtggaattgga
gagtgtgggcaggaggacggtgactgtagctgcaaagcccatgtaactggtgatgcctgc
gacacctgtgaagatgggtttttctctttggagaagagcaattactttggctgtcaaggg
tgtcagtgtgacattggtggagcactcaccaccatgtgtagtgggccctcgggagtatgc
cagtgcagagagcacgtggaggggaaacagtgccagaggcctgaaaataactactacttc
ccggatttgcaccacatgaagtatgaggtcgaagatggcactggacctaatggaagaaac
ctgcggtttggatttgatcccctggtattccctgagtttagctggagaggatatgctcca
atgacctcagtccagaatgaagtaagggtgagattgtctgtgaggcagtccagcctctcc
ttgttccgcatcgttctgagatacatcagtcctggaacggaagccatatccggccgaatc
actctttactcatcgcagggagattcggatgctttgcaaagcagaaaaatcacctttccc
ccgagtaaagagccagcctttgtcacagtccctgggaatggctttgcaggcccattctcc
atcacacctgggacgtggattgcttgcatccaggtggaaggagtccttctggactacctg
gtgctgcttcccagggactactatgaagcattcaccctgcaagtgccagtcacagagcca
tgtgcccacacaggatctccccaggacaactgtttgctttaccagcatttaccactgact
gcattctcctgtaccctggcttgtgaggccagacacttcctgctggatggagagctgaga
cccttggcaatgaggcagcccacacccacacacccagccatggtggacctcagcgggaga
gaggtagaactgcagcttcgtctgcgggtcccacaggttggccactacgtggtcctgctg
gagtatgccacggaggtggagcagctttttgtggtggacgtgaatctgaagagctcaggg
tctgccttggcaggccaggtgaacatatacagctgcaagtacagcatcccgtgcaggagt
gtggtgattgacagcctgagtcgcacggctgtacatgagctgttggcagatgcagacatt
cagctcaaggcgcacatggcccatttccttttgtatcacatttgtattataccagctgaa
gaattctcaactgaatatttgagacctcaagtccactgcattgccagctacaggcagcat
gctaatccaagtgcttcctgtgtctccctggcccatgaaactcctccaacagcctcaatt
ttggatgctacaagtaggggccttttctctgccctacctcatgagccttcctctcctgca
gatggagttactctgaaggcaccacagagtcaagtgaccctgaaaggactcataccacac
ctgggccgacacgtctttgtcatccatttttatcaagcagagcacccagggtttcccact
gaggtgattgtgaatggaggaagacagtggtcaggttccttccttgcctccttctgtccc
cacttacttggctgccgggaccaggtgatctctgatggccaagtggagtttgacatctct
gaagcagaggtagctgtgacagtgaagattccagatggaaagtccttaacattggtccgg
gttctagtggtacctgcagagaattacgactaccaaattcttcacaaaacaacagtggac
aagtcctccgagttcatcagcagttgtggaggagacagcttttatattgatccccaggca
gcctctggattctgtaagaattctgcaaggtccctggtagccttttaccataacggtgcc
ataccctgtgagtgcgaccctgctgggactgccggccaccactgtagtcctgagggtggg
cagtgcccttgccggcccaatgtcatcgggaggcagtgcagccgctgtgcgacaggctac
tatggattcccatactgcaagccttgtaattgtggcagacgcctttgtgaagaggtgaca
gggaagtgtctctgcccaccccacacagtcaggcctcagtgtgaggtctgtgagatgaat
tccttcaactttcaccctgtggctggctgtgacgtctgcaactgctccaggaagggcacc
attgaggcggccgtctctgagtgtgacagggacagcgggcagtgcaggtgcaagcctaga
gtcacagggcagcagtgtgacaagtgtgctcctggcttctaccagttccctgagtgtgtc
ccctgcagctgtaacagagatgggactgagcccagcgtatgtgacccagagactggggct
tgcatgtgcaaggaaaatgtagagggcccccaatgtcaactgtgtcgagaaggatcattc
tacctggacccaacaaacccaaagggttgtaccaagtgcttctgttttggagtgaatact
gactgtcagagttcgcataagcaacgagctaagtttgtagacatgatgggctggcgtctg
gagacagcagatggagttgatgtccctgtgtccttcaaccctggcagcaacagcatggtg
gcagatctgcaggagctgccaccctcagttcacagtgcatcctgggtggcacctccatcc
tacctaggtgataaggtatcatcgtacggcggctacctcacctaccacgccaagtccttt
ggcttacctggagatatggttcttctgggaaagcagccagatgtgcagctcactggtcaa
cacatgtccctcatccataaggaacccagcgacccacggccagacaggctgcatcacgga
agagtgcaagtgattgagggaaacttcagacacgaaggcagcagtgccccagtgtcccgg
gaggagctgatgactgtgctgtccagactggaaagactccacatccggggcctccatttc
accgagacacagcggctcaccttgggtgaggtagggctggaggaggcctctgacacggga
agcggacccagggctcatcttgtggagatgtgtgcctgcccccctgactacacaggtgac
tcatgccagggttgtcgccctggatactattgggacaacaaaagcttacctgtaggaagg
tgtgttccctgcaattgcaacggacattcaaatagatgccaggatggctccgggatatgc
attaactgtcagcacaacacagctggggagcactgtgagcgttgccaagcaggtcactat
ggaaatgccatccacggatcttgtagggtctgcccctgccctcataccaacagttttgcc
accggctgtgctgtggatggtggagctgtgaggtgtgcctgcaaacccggatacacagga
acacagtgtgagaggtgtgcaccaggatattttgggaacccccagaaatttggaggtagc
tgccagccatgcaattgtaacagcaatggccagttaggtccttgcgaccccctaactgga
gactgtgtaaaccaagaacccaaagatggcagccctgcagaagaatgtgatgactgcgac
agctgtgtgatgacgctcttaaatgacttggcctccatgggtgaggaactccgcctggtg
aagtcaaagctgcaggggctgagtgtgagcacgggtgctctggaacagatccggcacatg
gagacgcaggccaaggacctgaggaaccagctgcttggcttccgttctgccacctcaagt
catgggtccaaaatggatgacctggaaaaagagctgagtcatttgaaccgggaatttgaa
actctgcaagaaaaggcacaggtcaattccagaaaagcacaaacattatataacaacatt
gatcagacaatccaaagtgccaaagaactggacatgaagattaaaaacatcgttcagaat
gtgcacattctcctgaagcagatggcgaggccaggtggagaaggcacggacttgccagtg
ggtgactggtccagggagctggccgaagctcaacgcatgatgcgagacctgcgaagccga
gactttaaaaagcacctccaagaagcagaggccgagaaaatggaagcccagctcttactg
caccggatcaggacctggctggaatcccaccaggtggagaacaacggactgctaaagaat
attcgggactccttaaatgattatgaagacaaacttcaggacctacgttccatcctccag
gaggcagctgcccaggcaaagcaggccactggcatcaaccatgaaaatgagggggttctc
ggagccatccagagacaaatgaaagaaatggattccctgaagaatgacttcaccaagtac
ctggccacagccgactcttccctgctgcagaccaacaatctactgcagcagatggacaaa
agccagaaggaatatgaaagcttagctgctgctttaaatggagcaagacaggaactgagt
gacagagtgcgagaactgtccagatcgggtggcaaagcaccgctggtggtggaggcagag
aagcatgcacagtctttacaggagctggcaaagcagctggaagagataaagagaaacacc
agcggggatgagctggtgcgttgtgctgtggatgctgccacggcctatgagaacatcctc
aatgccatcagagcagcagaggatgcagccagcaaggccaccagtgcctccaagtctgcc
ttccaaacagtgataaaggaagaccttccaaaaagagctaagaccctgagttctgacagc
gaggaactgttaaatgaagccaagatgacacagaaaaggctacagcaagtcagtccagct
ctcaacagcctacaacaaaccctgaagactgtatcagttcagaaggacctgctagatgcc
aacctcactgttgcccgtgatgatcttcatgggatacagagaggtgatatcgacagtgtg
gtgatcggtgcaaagagcatggtcagggaagccaacggaataacaagcgaggtcctggac
gggctcaaccccatccagacagatttgggaaggattaaggacagctatgagagcgcacgg
cgtgaagacttcagcaaggctctggtcgatgccaataactcagtaaagaaattaaccagg
aagttgcctgatctttttatcaagattgaaagtatcaaccaacagttgctgcccctgggg
aacatctctgacaatgtggaccgaatccgagaactcattcagcaggccagagatgctgca
aacaaggttgcaattcccatgaggttcaatggtaaatctggtgtcgaagtccgactgccg
aatgacctagaagatttaaaaggatacacatctctgtctttgtttctccaaagacctgac
ttgcgagagaacggaggcactgaggatatgtttgtaatgtaccttgggaataaggatgcc
tccaaggactacattggcatggcggttgtagatggccagctgacatgtgtgtacaacctg
ggggaccgagaggctgaagttcagatagaccaggtcctgacggagagtgagtctcaggag
gcagttatggaccgggtgaagttccagaggatatatcaatttgccaagcttaattacacc
aaagaagccacatctactaaacccaaagcccctggggtctatgacatggagagcgccagt
agcaacacactccttaatttggatcctgagaatgcagtattttacgtcggcggttatcca
cctggttttgagcttccacgcagactgcggttccctccatacaaaggctgtatcgaacta
gatgacctcaacgaaaacgttctaagcttgtacaatttcaagacaactttcaatctcaat
accactgaagtagagccttgtaggaggagaaaggaagagtcggacaaaaattactttgaa
ggcacaggctatgctcgaattcctacccagccaaatgctcccttcccaaacttcatgcag
accatccaaactactgtggacagaggtctactgttcttcgcagaaaaccaggataacttc
atatctctgaatatagaagacggcaatctcatggtaaaatacaaactaaattcagagcca
cccaaagagaaaggaattcgagacaccatcaacaacgggagagatcacatgattttaatc
tcaattggaaaatcacaaaagcggatgttgataaatatgaataaacatagtataataatt
gaaggggaaatatttgatttcagcacatattacttgggaggaattccaattgcaatcaga
gaaaggtttaacatctcaacgcctgctttccaaggctgcatgaagaatctgaagaaaacc
agtggggttgtcaggttgaacgatacagtgggtgtgaccaaaaagtgctcagaagactgg
aagcttgtgcgaaccgcctcgttctccagaggaggacagatgagtttcacaaacttggat
gtgccctcacttgaccgcttccagctctcctttgggttccagacctttcaacccagcggt
acactactaaaccatcagacacggacaagtagcctactggtcaccctggaagatggtcat
attgcgttgagcaccagggacagcagcagcccgattttcaagtctccagggacctacatg
gatggtttactgcatcatgtatctgtaataagcgacacctcaggcctgcgccttctcatc
gatgaccaggttctgagaagaaaccaaaggctcgctagcttctctaatgcccagcagtcg
ctcagcatgggaggcggttatttcgagggttgtatcagcaacgtttttgtccaaaggatg
tcacagagtccagaagtcctggatatggccagcaagtctactaagagggatgcattccta
ggaggctgcagtttaaacaagccaccttttcttatgttgtttaagagtcccaagggattt
aacaaggcccggagtttcaatgtcaatcagctgttgcaagatgcacctcaggctgcaagg
agcatagaggcttggcaagatgggaagtcctgcctaccacctctgaacaccaaggccact
cacagagccctgcagtttggggacagtcctaccagccacttgctattcaagcttccccag
gagctgctgaaacccaggttacagttttctttggacatacagacaacttcctccagaggg
ctagtgtttcacacaggcaccagggactcctttgtggctctctatctctcagaaggccat
gtcatctttgccttgggggcaggagggaagaaactgagactcagaagcaaagagagatac
cacgatgggaagtggcactcggtggtgtttggactgagtggaagaaaggtgcacctggtg
gtggatgggctgagggcccaggaaggcagtttgcctggaaactctaccatcagccccaga
gaacaggtttacctggggttgtcaccatcaagaaagtcaaagagcctcccccagcacagt
tttgtggggtgtctgaggaacttccagttggactcaaaacccctggattccccctctgcg
aggtctggggtatctccctgcttaggtggctctttggagaaaggcatttatttctcccaa
ggaggaggtcacgtggtcctagccaattccgtgtccttggagccagcacttacgctcact
ctcagcattcgcccacgaagtctcaccggggtcttgatccacatcgcaagtcaatctgga
gagcacttaagtgtctacatggaggcagggaaggtcacgacctctatgaacagtgaggca
ggtgggaccgtgacatcaattacaccgaagagatctctgtgtgatggacaatggcactcg
gtgacagtctccattaaacagcacactctgcatctggaactggatacagacaatagctac
acagctgggcagctttccttcccaccgaacagcacccgagggtcactacacattggaggc
gtcccagacaaattgaaaatgcttacactccctgtgtggaactcattttttggctgtctg
aagaatattcaagtaaaccacatccctgtccccatcacagaagccaccgatgtccaaggt
tctgtcagcctgaatggctgccctgaccactaa

KEGG   Mus musculus (mouse): 16775Help
Entry
16775             CDS       T01002                                 

Gene name
Lama4
Definition
(RefSeq) laminin, alpha 4
  KO
K06241  laminin, alpha 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05143  African trypanosomiasis
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16775 (Lama4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16775 (Lama4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16775 (Lama4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16775 (Lama4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16775 (Lama4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16775 (Lama4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16775 (Lama4)
   05145 Toxoplasmosis
    16775 (Lama4)
   05143 African trypanosomiasis
    16775 (Lama4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 BORCS6 Rogdi_lz Sec34
Motif
Other DBs
NCBI-GeneID: 16775
NCBI-ProteinID: NP_034811
MGI: 109321
Ensembl: ENSMUSG00000019846
Vega: OTTMUSG00000034993
UniProt: P97927
LinkDB All DBs
Position
10 B1; 10 20.02 cM
AA seq 1816 aa AA seqDB search
MGWSTAWCSVLALWLLWCAVCSNAASGDGNAFPFDIEGSAVVGRQDPSETSDSGVTLGRL
PPAAERCDAGFFRTLSGECAPCDCNGNSHECLDGSGFCLHCQRNTTGEHCEKCLDGYIGD
SIRGTPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYVGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARTAKNCAV
CNCGGGPCDSVTGECLEEGFEVPTGCDKCVWDLTDDLRLAALSIEESKSGLLSVSSGAAA
HRHVTDMNSTIHLLRTRLSERENQYTLRKIQINNSENTLRSLLPDVEGLHEKGSQASRKG
MLVEKESMDTIDQATHLVEQAHNMRDKIQEINSKMLYYGENQELGPEEIAEKLVLAQKML
EEIRSRQPFLTHRELVDEEADEAQELLSQAENWQRLHNDTRSLFPVVLEQLDDYNAKLSD
LQESINQALDHVRDAEDMNRAITFKQRDHEKQHERVKEQMEVVGASLSMSADSLTIPQLT
LEELDEIIKNASGIYAEIDGAKNELQGKLSNLSNLSHDLVQEATDHAYNLQQEADELSRN
LHSSDMNGLVQKALDASNVYENIANYVSEANETAELALNITDRIYDAVSGIDTQIIYHKD
ESDNLLNQARELQAKADSSNDEAVADTSRRVGGALWRKGALRDRLNDAVKQLQAAERGDA
HQRLGQSKLFIEEANKTTAAVQQVTTPMANNLSNWSQNLQTFDSSAYNTAVDSARDAVRN
LTEVVPQLLDQLRTVEQKRPASNISASIQRIRELIAQTRSVASKIQVSMMFDGQSAVEVH
PKVSVDDLKAFTSISLYMKPPPKPAEPTGAWVADQFVLYLGSKNAKKEYMGLAIKNDNLV
YVYNLGMKDVEILLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGE
FAGDDSLLDLTPEDTVFYVGGVPANFKLPASLNLPSYSGCLELATLNNDVISLYNFKHIY
NMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEIRTPADN
GLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEISIIYHN
DKKMILVVDRRHVKSTDNEKKKIPFTDIYIGGAPQEVLQSRTLRAHLPLDINFRGCMKGF
QFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGGFNFRT
LQPNGLLFYYTSGSDVFSISLDNGTVVMDVKGIKVMSTDKQYHDGLPHFVVTSISDTRYE
LVVDKSRLRGKNPTKGKAEQTQTTEKKFYFGGSPISPQYANFTGCISNAYFTRLDRDVEV
EDFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPKTNKQGEKSKDAPSWDPIGLKFL
EQKAPRDSHCHLSSSPRAIEHAYQYGGTANSRQEFEHEQGDFGEKSQFAIRLKTRSSHGM
IFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFIREKSSGRL
VIDGLRVLEERLPPSGAAWKIKGPIYLGGVAPGRAVKNVQITSVYSFSGCLGNLQLNGAS
ITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSSGTLVH
GHSVNGEYLNVHMRNGQVIVKVNNGVRDFSTSVTPKQNLCDGRWHRITVIRDSNVVQLDV
DSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDSRPVSFSK
AALVSGAVSINSCPTA
NT seq 5451 nt NT seq  +upstreamnt  +downstreamnt
atgggttggagcacagcttggtgctcagtcctggccctgtggctcctctggtgtgctgtc
tgctccaacgcagcgtcaggggacggcaatgcgtttccttttgacatcgaggggagcgca
gtggtcggcaggcaagacccatcggagactagcgactcaggcgtgacactgggacgcctg
ccgcctgctgctgagagatgtgacgctggattcttccgcacactgtcaggagaatgtgca
ccctgtgactgtaatggcaattcccatgagtgcttggatggctccggattctgtctgcac
tgccagcggaacacaacaggagagcactgtgaaaaatgtctggatggctatattggagac
tccatcagaggcacaccccggttctgccagccgtgcccctgtcccttgccccacctggcc
aactttgcagaatcctgctacaggaaaaatggagctgttcggtgtatttgtaaagaaaac
tatgttggacctaactgtgaaagatgtgctcctggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcggatcccaacctgatctttgaa
gactgtgatgaaatcactggccagtgcaggaactgcttacgaaataccaccggattcaag
tgtgaacgctgtgcacctggttactatggagacgccaggacagccaagaactgtgcagtg
tgcaactgtgggggcggcccgtgtgacagtgtaaccggagagtgcttggaagaaggattt
gaagtccctacaggctgtgataagtgcgtctgggacttgaccgatgacctgcgattagca
gcgctctccatcgaagagagcaaatccgggctgctgagcgtgtcctctggcgctgcggcg
catagacacgtgaccgacatgaactctaccatccacctcctcagaacaaggctgtcagaa
agagaaaaccagtataccctaagaaagatacagataaacaactcggagaacacactgaga
agcctcctgcctgatgtagagggactccatgagaagggaagtcaagcctcaagaaagggt
atgctggttgagaaggaaagcatggatacaattgaccaagcaacccatcttgtcgagcaa
gcccacaacatgagggacaaaatccaagagatcaacagcaagatgctctactatggagag
aatcaggaacttggccccgaggaaatagctgagaagctggtgttggcccagaaaatgctg
gaagagatccgaagccggcagccattcctcacccatcgggagctggtggatgaggaggca
gatgaggcccaggaattgctgagccaagctgagaactggcagcggctgcacaatgacacc
cgctctttattccccgtggtgctggagcagctggacgactacaacgctaagctgtccgac
ctccaggaatccattaaccaggccctcgaccatgtcagggatgcagaagacatgaataga
gccatcactttcaagcagcgggaccatgagaaacaacatgagagagtgaaggaacagatg
gaagttgtgggtgcctctctgagtatgtctgcagactctcttaccatacctcagctcact
cttgaggaacttgatgagataataaagaatgcatctggaatttatgcagaaatagatgga
gccaaaaatgagctgcaaggaaaactatccaacctgagtaacctcagtcatgacttggtt
caggaagctacggaccatgcatacaatcttcaacaggaagccgatgagctaagcagaaat
ttgcacagttcagacatgaacgggctggtacagaaggctttggatgcatcaaacgtctat
gaaaatatcgccaattatgtcagtgaagccaacgaaacagcagaacttgctctgaatatc
actgatcgaatttatgatgctgtgagtgggattgacacgcagatcatttaccataaggat
gaaagtgacaaccttctcaatcaagccagagagctgcaggccaaggcagattctagcaat
gatgaagcagtggctgacaccagcaggcgtgtgggtggagccctgtggaggaagggcgcc
ctcagagacagactgaatgatgctgttaagcaactacaggcagcagagagaggggacgcc
caccagcgcctgggccagtccaagctcttcattgaggaagctaacaagacgacagcggct
gtccaacaggttaccacaccaatggctaacaacctcagcaactggtcccagaacctgcag
acctttgactcatctgcatataacactgcagtggactctgctcgggacgcagtgagaaac
ctcaccgaggttgtcccccagcttctggatcagcttcgtactgtggagcagaagcggcct
gcaagcaacatttctgccagcatccagaggatccgagagctcattgctcaaaccaggagt
gtcgcaagcaagatccaagtctccatgatgtttgatggccagtcagctgtcgaagtgcac
cccaaagtcagtgtggatgacctgaaggccttcacatccatcagcttgtacatgaagcct
cctccaaagccggcagagcccactggggcctgggtagcagatcagtttgtcctctacctc
ggaagcaaaaacgccaaaaaagaatacatgggtctggcaatcaaaaatgataacctggta
tacgtttacaatttggggatgaaagatgtggaaattctcctggattccaagcctgtgagc
tcctggcccgcttactttagtattgtcaagattgaaagggtagggaaacacggaaaggtg
ttcttgacagtccccagtctcagtagcacagcagaagaaaagtttattaagaagggggag
tttgcaggagatgactccttgctggatctgacccctgaggacactgtgttttacgttggt
ggggtgcctgcgaacttcaagctccctgccagcttaaacctgcccagctactcaggctgc
ctagagctggccactctgaataatgatgtgatcagcttgtacaacttcaagcacatctat
aatatggatccatcaaagtcagtgccctgtgccagggataaactggctttcactcagagt
agggctgccagctacttcttcgatggctccagttatgcagtggtgagggacatcacgagg
agagggaagtttggtcaggtgactcgctttgacatagaaatccgaacaccagctgacaat
ggccttgtgctcctgatggtcaatggcagtatgtttttcagcctcgaaatgcgcaatggc
tacctacatgtgttctatgactttggattcagcaatggccccgtgcatcttgaagacacg
ttgaaaaaagcccagattaatgatgcgaaatatcatgagatctcaatcatttatcacaac
gacaaaaaaatgattttggtggtggacagacggcacgttaagagcacagacaatgagaag
aaaaagattcctttcacggacatctacatcggaggtgcgccccaagaagtcttacagtcc
aggaccctaagagcacaccttcccctagatatcaactttagggggtgcatgaaggggttc
cagttccaaaagaaagatttcaatttactggagcagacagaaaccctaggagttggttat
ggatgcccagaggactctctgatatctcgcagagcatatttcaatgggcaaagttttatt
gcttcaattcagaaaatatctttctttgatggctttgaaggaggcttcaatttccgaaca
ttacagccaaatgggttactattctactacacatcagggtcggacgtgttttccatttca
ctggacaacggcactgttgtcatggacgtaaagggcatcaaggtcatgtcaacagacaag
cagtaccacgatgggctgccccacttcgtggtcacctccatctcagacacaagatatgaa
ctggtagtagacaaaagccgacttcgagggaagaatccaacaaaagggaaggcagagcag
actcaaacaactgagaagaagttctactttggtggctcacccatcagtcctcagtatgct
aatttcactggatgtataagcaatgcctactttaccaggttggatagagatgtggaagtc
gaagacttccagcgctattctgaaaaggtccacacttcactctatgagtgtccgattgag
tcgtcacctctgtttctccttcacaaaaaaggaaagaattcctcaaagcctaaaacaaac
aaacagggagagaagagtaaggatgcgccttcatgggatcctattggcctgaagtttctg
gaacagaaagctccaagagattcccactgccacctctccagcagccccagggcaatagaa
catgcctatcaatatggcggcacggccaacagtcgccaggagtttgaacacgaacaagga
gattttggtgaaaaatcccagtttgccattcgtctgaagacccgttcctcacatgggatg
attttctatgtctcagaccaagaagagaatgatttcatgaccctgttcttggcccatggt
cgcttggtctttatgtttaatgttggccataagaaactgaagattagaagccaggagaaa
tacaatgatggattgtggcatgatgtgatatttattcgggaaaagagcagtggtcgactg
gtcattgatggtctacgagtcctagaagaaaggcttccccctagtggcgctgcctggaaa
atcaagggtcccatttatctgggaggagtggctcccggaagagccgtgaaaaatgtccag
attacctccgtctacagcttcagtggctgccttggcaatctccagctcaatggtgcctcc
atcacctccgcttctcaaacgtttagcgtgaccccttgctttgaagggccaatggaaaca
ggaacttatttttccacagaaggcggctatgtggttctagatgagtctttcaatattggg
ttaaaatttgaaattgcctttgaagtccgcccccggagcagttctggaacccttgtccat
ggccacagcgtcaacggggaatacctgaacgtgcacatgagaaacggacaggtcatagtg
aaggtcaacaacggtgtcagagacttttctacctcagtaactcccaagcagaatctctgt
gatggcagatggcacagaattacagttattagagattcaaacgtggttcagttggatgta
gactcagaagtgaaccatgtagttgggccgttgaatccaaagccagttgatcacagggag
cctgtgtttgttggaggtgttccagagtctttactgacaccacgtttggctcccagcaaa
cccttcaccggctgcatccgccactttgtaattgacagccgccctgtgagcttcagtaaa
gctgccctggtcagtggtgctgtgagcatcaactcctgtcccacagcctga

KEGG   Mus musculus (mouse): 16776Help
Entry
16776             CDS       T01002                                 

Gene name
Lama5, AA408760, AA408762, AI853660, [a]5, laminin-511, mKIAA0533
Definition
(RefSeq) laminin, alpha 5
  KO
K06240  laminin, alpha 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16776 (Lama5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16776 (Lama5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16776 (Lama5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16776 (Lama5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16776 (Lama5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16776 (Lama5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16776 (Lama5)
   05145 Toxoplasmosis
    16776 (Lama5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 16776
NCBI-ProteinID: NP_001074640
MGI: 105382
Ensembl: ENSMUSG00000015647
Vega: OTTMUSG00000016271
UniProt: Q61001 Q3TZ05
LinkDB All DBs
Structure
PDB: 

Position
2 H4; 2 102.7 cM
AA seq 3718 aa AA seqDB search
MAKRGGQLCAGSAPGALGPRSPAPRPLLLLLAGLALVGEARTPGGDGFSLHPPYFNLAEG
ARITASATCGEEAPTRSVSRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAH
PVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERS
TDFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLV
NGRPGALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDIS
IGGRCVCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANE
CQSCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQHHTTGINCERCLPGFFRA
PDQPLDSPHVCRPCDCESDFTDGTCEDLTGRCYCRPNFTGELCAACAEGYTDFPHCYPLP
SFPHNDTREQVLPAGQIVNCDCNAAGTQGNACRKDPRLGRCVCKPNFRGAHCELCAPGFH
GPSCHPCQCSSPGVANSLCDPESGQCMCRTGFEGDRCDHCALGYFHFPLCQLCGCSPAGT
LPEGCDEAGRCQCRPGFDGPHCDRCLPGYHGYPDCHACACDPRGALDQQCGVGGLCHCRP
GYTGATCQECSPGFYGFPSCIPCHCSADGSLHTTCDPTTGQCRCRPRVTGLHCDMCVPGA
YNFPYCEAGSCHPAGLAPANPALPETQAPCMCRAHVEGPSCDRCKPGYWGLSASNPEGCT
RCSCDPRGTLGGVTECQGNGQCFCKAHVCGKTCAACKDGFFGLDYADYFGCRSCRCDVGG
ALGQGCEPKTGACRCRPNTQGPTCSEPAKDHYLPDLHHMRLELEEAATPEGHAVRFGFNP
LEFENFSWRGYAHMMAIQPRIVARLNVTSPDLFRLVFRYVNRGSTSVNGQISVREEGKLS
SCTNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLLDYVVLLPS
TYYEAALLQHRVTEACTYRPSALHSTENCLVYAHLPLDGFPSAAGTEALCRHDNSLPRPC
PTEQLSPSHPPLATCFGSDVDIQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQRAP
QQGVLNLHPCPYSSLCRSPARDTQHHLAIFYLDSEASIRLTAEQAHFFLHSVTLVPVEEF
STEFVEPRVFCVSSHGTFNPSSAACLASRFPKPPQPIILKDCQVLPLPPDLPLTQSQELS
PGAPPEGPQPRPPTAVDPNAEPTLLRHPQGTVVFTTQVPTLGRYAFLLHGYQPVHPSFPV
EVLINGGRIWQGHANASFCPHGYGCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLWLDY
VLIVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHISPSSSSPFCRNAATSLSLFYNNGA
LPCGCHEVGAVSPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELT
GQCICPPRTVPPDCLVCQPQSFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCRCRPN
VAGRRCDTCAPGFYGYPSCRPCDCHEAGTMASVCDPLTGQCHCKENVQGSRCDQCRVGTF
SLDAANPKGCTRCFCFGATERCGNSNLARHEFVDMEGWVLLSSDRQVVPHEHRPEIELLH
ADLRSVADTFSELYWQAPPSYLGDRVSSYGGTLHYELHSETQRGDIFIPYESRPDVVLQG
NQMSIAFLELAYPPPGQVHRGQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIRALF
SQTSSSVSLRRVVLEVASEAGRGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLG
RCVPCQCHGHSDRCLPGSGICVGCQHNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLA
VPSNNFADGCVLRNGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPN
MIFSDCDPLTGACRGCLRHTTGPHCERCAPGFYGNALLPGNCTRCDCSPCGTETCDPQSG
RCLCKAGVTGQRCDRCLEGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGTTGPQ
CLECAPGYWGLPEKGCRRCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPG
GHGIHCEVCDHCVVLLLDDLERAGALLPAIREQLQGINASSAAWARLHRLNASIADLQSK
LRSPPGPRYQAAQQLQTLEQQSISLQQDTERLGSQATGVQGQAGQLLDTTESTLGRAQKL
LESVRAVGRALNELASRMGQGSPGDALVPSGEQLRWALAEVERLLWDMRTRDLGAQGAVA
EAELAEAQRLMARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALNQAVNTTREA
EELNSRNQERLKEALQWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKEDLEHLA
ASLDGAWTPLLKRMQAFSPASSKVDLVEAAEAHAQKLNQLAINLSGIILGINQDRFIQRA
VEASNAYSSILQAVQAAEDAAGQALRQASRTWEMVVQRGLAAGARQLLANSSALEETILG
HQGRLGLAQGRLQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAE
ALSTATHVQSQLQGMQKNVERWQSQLGGLQGQDLSQVERDASSSVSTLEKTLPQLLAKLS
RLENRGVHNASLALSANIGRVRKLIAQARSAASKVKVSMKFNGRSGVRLRTPRDLADLAA
YTALKFHIQSPVPAPEPGKNTGDHFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKAGPT
TLSIDENIGEQFAAVSIDRTLQFGHMSVTVEKQMVHEIKGDTVAPGSEGLLNLHPDDFVF
YVGGYPSNFTPPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCARSKATG
DPWLTDGSYLDGSGFARISFEKQFSNTKRFDQELRLVSYNGIIFFLKQESQFLCLAVQEG
TLVLFYDFGSGLKKADPLQPPQALTAASKAIQVFLLAGNRKRVLVRVERATVFSVDQDNM
LEMADAYYLGGVPPEQLPLSLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCT
ADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGFRGTQDNNLLYYRTSPDGPYQVSL
REGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTGVWLYVDDQLQLVKSHERTTPMLQL
QPEEPSRLLLGGLPVSGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSVGCTPAQ
LIETSRATAQKVSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFVGISPSHRNR
LHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRA
GQWHRVSVRWGMQQIQLVVDGSQTWSQKALHHRVPRAERPQPYTLSVGGLPASSYSSKLP
VSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLELPKAKMPY
VSLELEMRPLAAAGLIFHLGQALATPYMQLKVLTEQVLLQANDGAGEFSTWVTYPKLCDG
RWHRVAVIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHLGSLPKSSTARPELPAYRG
CLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH
NT seq 11157 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgcggagggcagctctgcgcggggagcgcaccgggcgctcttggcccccgg
agccccgcgccacggccgctgctactgctgctggctggactggcgctggtaggcgaggcg
cgcactcccgggggcgatggcttcagcctgcacccgccctacttcaacctggcggagggc
gctcgcatcaccgcgtccgcgacctgcggcgaggaggccccgacgcgcagtgtctcacgc
cccaccgaggacctctactgcaagctggttgggggtccggtggctggcggagatcccaat
cagacaatccagggccagtactgtgacatctgtacagctgccaacagcaacaaggcacac
cctgtgagcaacgccatcgatggcacggagcgctggtggcagagcccacccctgtcccgt
ggcctggagtacaatgaggtcaacgtcacactggacctgggccaggtgttccatgtggcc
tatgtgctcatcaagtttgccaactcacctcggcctgacctctgggtgctggagcggtcc
acagacttcggtcacacttatcagccgtggcagttctttgcctcctccaagagggattgt
ttggagcggtttggacctcggactctagagcgcatcacgcaggacgacgacgtcatctgc
accacagaatactcgcgaatagtgcctttggagaatggcgagattgtggtgtccttggta
aatgggcgccctggggccttgaacttctcctactcaccgttacttcgagacttcaccaaa
gccaccaacatccgcttgcggtttctgcgaaccaacacgctactgggccacctcatgggc
aaggcgctgcgggaccccacagtcacccgcaggtattattacagcatcaaagacatcagc
attggtgggcgctgtgtctgtcatggccacgcagatgtctgtgacgccaaggacccattg
gatcctttcaggctgcagtgtgcctgccagcacaatacatgtggaggctcttgtgaccga
tgctgtccaggcttcaaccagcagccgtggaagcccgccaccacggacagcgccaatgag
tgccagtcctgcaattgccacggccatgcctacgactgttactacgaccctgaggtggat
cggcgcaatgccagccagaaccaggacaacgtgtaccagggtggaggtgtctgcctggat
tgccagcatcacactacgggtatcaactgtgagcgttgtctgcctggcttcttccgtgcc
cctgaccagcctctcgactcacctcatgtctgtcggccctgcgactgtgagtcagacttc
acggatgggacctgtgaagacttgacgggccgctgttactgcaggccgaacttcacagga
gagctatgtgctgcctgcgctgagggctacacggacttcccacactgctaccctctgcct
tcatttccccacaatgacacgagagaacaggtgcttcccgctggacaaatcgtgaactgt
gattgcaatgctgcagggacccagggcaatgcctgccggaaggacccaaggttgggacgg
tgtgtctgcaaacccaacttccggggtgcccactgtgagctctgtgctcctggattccac
gggcctagctgccacccatgccagtgttccagccctggggtagccaacagcctctgtgac
ccagagtctggccagtgcatgtgccgcaccggctttgagggggacaggtgtgaccactgt
gcccttggctatttccacttccctctctgtcagctgtgtggctgcagcccagcagggacc
ttgcctgaaggctgtgacgaggctggccgctgccagtgccgacctggctttgacggtcct
cactgtgaccgatgccttccaggataccatgggtatcccgactgtcacgcttgtgcctgt
gaccctcggggggccctggatcagcagtgtggagtgggcggtttgtgccactgccgtcct
ggctacacaggtgccacttgtcaggaatgtagccccggcttctacggcttccccagctgc
atcccctgccactgctctgccgatggctccttgcatacaacctgtgacccgacaaccggc
cagtgtaggtgtcgaccccgagtgacaggactacattgtgatatgtgtgtaccaggcgcc
tataacttcccctactgtgaagctggctcttgtcatcctgctggtctggccccagccaat
cctgcccttcctgagacacaggctccctgtatgtgccgggctcacgtggaagggccaagc
tgtgatcgctgtaaacctgggtactgggggctgagcgccagcaaccctgaaggctgcaca
cgctgcagctgtgacccacgaggcaccctgggtggagttactgagtgccagggcaatggg
cagtgcttctgcaaggctcacgtgtgtggcaagacctgtgcagcctgcaaggatggcttc
tttggcctggattatgctgactactttggctgccgtagctgtaggtgtgatgttggtggt
gccctgggtcaaggctgtgaaccaaagacaggtgcctgcaggtgccgccctaacacccaa
ggacccacctgtagcgagccagcgaaggaccactacttgccagacctgcaccacatgcgg
ctggaactagaggaggcggccactcccgagggccacgctgtacgctttggcttcaacccc
ctggagtttgagaactttagctggagaggctacgcacacatgatggctatccagcccagg
attgtggccaggctgaacgtgacctcccctgacctctttcggctggttttccgatatgtc
aaccgtggatcaaccagcgtgaatgggcagatctctgttcgtgaagagggcaagctttcc
agctgtaccaactgcacagagcagagccagccagtggctttcccacccagcactgagcct
gcctttgtcactgtgccccagaggggctttggggaaccctttgtgctgaaccccggcatc
tgggccttgctggtcgaggctgaaggtgtactcttggactacgtggtcctactgcccagc
acctactatgaggcagctctcctacagcatcgagtaacggaggcctgtacctaccgtccc
tcagccctgcactccacagagaactgtcttgtctatgctcacctacccctggatggcttc
ccttcagcagctggaactgaggccctgtgtcgccatgacaacagcctgccccggccctgc
cccacagagcagctcagcccctcacacccaccgctggcgacctgcttcggcagtgatgtg
gacatccagctcgagatggccgtgcctcagcctggccaatatgttctcgtggtggaatat
gtcggtgaggattcacaccaagagatgggagtggctgtgcacacccctcagagagccccc
cagcaaggggtgctcaacctccacccctgcccatacagctccctgtgccggagtccggct
cgggacacccagcatcatctagccatcttctacctggactctgaggctagcatccggctc
acagctgagcaagctcacttcttcctgcacagcgtcaccctggtacctgtggaggagttc
agtactgagtttgtggagccccgggtcttctgtgtgagcagtcatggaactttcaacccc
agcagtgctgcctgtctagcctcccgattcccgaagccaccgcagcccatcatccttaag
gactgccaggtcttgccgctgcctcccgacctgcctctgactcagtctcaggagctctca
ccaggtgcaccccccgagggaccacagcctcggccgccaactgcggtggatcctaatgca
gaacccaccttgctgcgccacccccagggcacggtggtcttcaccacccaggtgcccacc
ctgggccgctatgcctttctgctgcacggctaccagccggtccacccctccttccctgtg
gaggtactcattaatggtggccgcatctggcagggccacgccaacgccagcttttgtcct
catggttatggctgccgtaccctggtgttgtgtgagggtcagacgatgctggatgttaca
gacaacgagctcaccgtgactgtgcgtgtgccagaaggccggtggctctggctggactac
gtactcattgtccctgaggatgcttacagctccagttacctccaagaggagcctttggac
aaatcctatgacttcatcagccactgtgccacccagggctaccacattagccccagcagc
tcatctccattctgccggaatgccgccacctccttgtctctcttctacaacaacggggcc
ctcccttgtggctgccacgaggtgggtgccgtaagccccacgtgcgagcccttcgggggc
cagtgtccctgccggggccacgttattggccgtgactgttcccgctgtgccaccggctac
tggggtttccccaactgcaggccctgtgactgtggagcccgcctgtgtgacgagctcacg
ggccagtgtatctgtccaccacgcactgttccccctgactgcttggtctgccagccacag
agctttggttgccaccccttggtgggctgtgaggagtgtaactgctcagggcccggcgtc
caggagctgacggaccctacctgtgacatggacagcggccagtgcagatgcagacccaat
gtagctggacgtcgctgtgatacctgtgccccgggcttctatggctatcctagctgtcgc
ccctgtgactgccatgaggcaggcaccatggctagcgtgtgtgaccccctcacaggccaa
tgccattgcaaggagaacgtgcagggctcaagatgtgaccagtgtcgcgtggggaccttc
tccttggatgctgctaaccccaagggctgtacccgctgcttctgtttcggggccacagag
cgctgtgggaactctaacctcgcccgccatgagttcgtggacatggagggctgggtgctg
ttgagcagtgaccggcaggtggtaccccacgagcatcggcctgagatagagctgctgcac
gcagatctgcgctctgtggctgacactttctcagagctgtactggcaggctccgccctcc
tatctgggagacagggtgtcatcctacggtggaaccctccactatgagctgcactcagag
acccagcgaggtgatatcttcattccctacgagagccggccggacgtcgtgctgcagggc
aaccaaatgagcatcgccttcctggaactggcgtaccctccgcctggccaggttcaccga
ggacagctacagctggtagaggggaacttccggcacttggagactcacaaccccgtgtcc
cgagaagaactcatgatggtgctggccggcctggagcagctgcagatccgtgctctcttc
tcgcagacctcttccagtgtctccttgcgtagagtggtactggaggtggctagcgaggct
ggtagggggcctccagccagcaatgtggaactgtgtatgtgccctgccaactaccgtggg
gactcgtgccaggaatgtgcccctggctattaccgggacaccaagggtctcttcctaggc
cgatgtgtcccctgtcagtgccatggccattcagatcgctgccttcctggctctggcatt
tgtgtgggctgccagcacaacacagaaggggaccaatgtgagcgctgtaggcctggcttt
gtcagcagtgatcccagtaaccctgcatccccatgtgtgagctgcccttgccccttggca
gtgccctccaataattttgcagacggttgcgtcttaagaaatggccgaacccagtgcctc
tgcaggccaggctatgctggtgcctcctgcgagcggtgtgcacctggcttttttgggaac
cccctggtgctaggcagctcctgtcagccctgcgactgcagcggtaatggagaccccaac
atgatcttcagtgactgcgaccccctgacgggtgcctgtcgaggctgcctccgtcacacc
actgggccccactgtgaacgctgtgccccaggcttctatggcaatgctttgttgccaggc
aactgcacccggtgtgactgttccccatgtgggacagaaacctgtgatccccagagtgga
cgctgcctgtgcaaagcaggcgtgactggacaacgttgtgaccgctgtttggaaggatac
ttcggttttgagcaatgccagggctgccgcccttgtgcctgtggaccagctgccaagggc
tccgagtgccaccctcagagcggtcagtgtcactgccagccagggaccacaggaccccag
tgcctcgagtgcgcccctggctactggggcctcccagagaagggctgcaggcgctgccag
tgtccccgaggccactgtgacccacacacgggccactgcacctgtcccccggggctcagc
ggggaacgctgtgacacctgcagccagcagcaccaggtgcctgtaccgggcaagcctggg
ggccatggcatacactgtgaagtgtgtgaccactgtgtggttctccttctggatgacctc
gagcgggctggtgccctcctccccgctatccgtgagcagctgcagggtatcaatgccagc
tccgcggcctgggccaggctgcacaggctgaatgcctccattgctgacctgcagagtaaa
ctccggagcccaccgggaccccgctaccaggcagcacagcagctacagactctagagcag
cagagtataagccttcaacaggacacggagaggctgggcagtcaggccacaggggtccaa
ggtcaggcaggccagctactggacaccacagagtccacactgggccgggcacagaagttg
ttggagtctgtgcgagctgtgggccgtgccctgaatgagctggcatctcgcatgggccaa
ggatctccaggcgatgccttggtaccgtctggcgagcagctgcgctgggctctggctgaa
gtggagcggctgctctgggatatgcggacgcgtgacctgggggcccagggggcagtggca
gaggccgaactggccgaagcccagaggctgatggctcgtgtccaggagcagctgaccagc
ttctgggaggagaaccagtcattggccacacacattcgggaccagctggctcagtatgag
tctggcctcatggatcttcgtgaggccctgaaccaggccgttaataccacccgggaggct
gaggaactcaacagccgcaaccaggaacggctgaaggaagccctgcaatggaaacaggaa
ctgtcccaggacaatgccaccctgaaggccactcttcaagctgccagtctcatcttgggc
catgtttctgagcttctgcagggcatagaccaggctaaggaggacctagagcacctggcg
gccagcctggatggagcctggacacccttactgaagaggatgcaggccttttcccctgcc
agcagcaaggtggacttggtagaggctgctgaggcccacgctcagaagctgaaccagctg
gcaatcaacctgtctggcatcatccttggcatcaatcaggaccgcttcatccagagggct
gtggaagcctccaatgcctacagcagcatccttcaggccgttcaggctgccgaggatgcg
gcaggccaggcactgaggcaggccagccgcacatgggagatggtggtgcagcggggccta
gcagctggagcccggcagctgttagccaacagcagtgccctggaggagaccatccttgga
caccaggggaggctgggccttgctcagggccgtctgcaggctgcggggatccagcttcat
aatgtctgggccaggaagaaccagctagcagcccagatccaggaggcacaagccatgctg
gccatggacacgagcgagaccagtgagaagattgctcacgccaaggctgtggctgccgaa
gccctcagtacggccacccacgtgcagtctcagcttcagggtatgcagaagaatgtggag
aggtggcagagccagctgggaggcctgcaaggccaggacctgagccaggtggaacgggat
gcaagcagttcagtgtccaccctggagaagacattgccacagctgctggccaaactgagc
cgtctagagaaccgtggagttcacaatgccagcctggctttgtctgccaacattggtcgt
gtgcgcaagctcattgcccaagcccggagtgccgccagcaaggtcaaggtgtccatgaag
ttcaatgggcgttcaggggtacgactgcgtaccccacgagaccttgccgaccttgctgcg
tacactgccctcaagttccacatccagagcccagtgccagcgcccgaacctggcaagaac
acgggggaccactttgttctgtacatgggcagccgccaggccactggggactacatggga
gtgtctctgcgtaatcagaaggtgcactgggtgtacaggctaggaaaggctggccccaca
actctcagcatcgacgagaacatcggggagcagtttgcagccgtcagcatcgacaggacc
ctccagtttggccacatgtctgtcaccgtggagaaacagatggttcatgagatcaaggga
gacacggtggcccctgggagcgagggactactcaacctgcatcctgacgattttgtcttc
tacgtgggaggataccccagcaacttcacgccccctgaacccctccgattccctggctac
ctgggctgcattgagatggaaacactgaatgaggaggtggtcagcctctacaattttgag
cagaccttcatgctggacacggcagtagataaaccttgtgctcgctccaaggccaccggt
gacccatggctcacagatggctcctacctggatggcagtggctttgcccgcatcagcttt
gagaagcagttcagcaacacaaaacgctttgaccaggagctgcggcttgtgtcctacaat
gggatcatctttttcctcaagcaagagagccagttcttgtgcctggcagtgcaggaaggc
accctggtgctcttctatgacttcggctctggcctgaagaaggccgacccactgcagccc
ccacaagccttgacggcagccagcaaggcgatccaagtgtttctattggctggcaatcgc
aaacgtgtgttggtgcgtgtggagcgggccactgtgttcagcgtagaccaggataacatg
ctggagatggctgatgcctactacttgggaggtgtgccacctgaacagctgcccttgagc
ctacggcagctcttcccctccggaggctctgtccgtggctgcatcaagggtattaaggct
ctgggcaagtacgtggacctcaaacggttgaacaccacgggcatcagtttcggctgcacc
gctgacctgctagtgggacgcaccatgacttttcacggccacggcttcctgcccctggca
cttcctgatgtggcacccatcaccgaagtggtctattctggctttggctttcgtggcacc
caggacaacaacctgctgtattaccgtacctccccggatgggccgtaccaggtatccctg
agggagggccacgtgacactccgttttatgaaccaagaggtggaaactcaaagggtcttt
gctgatggtgctcctcactatgttgccttctatagcaatgtcacaggggtatggctgtat
gtggatgaccagctacaactagtaaagtctcatgagagaacaactcccatgctccaacta
cagcccgaggaaccctcacggcttctcctgggaggcctgcctgtgtctggtaccttccac
aacttcagtggctgcatcagcaatgtttttgtacagcgacttcggggaccacagcgtgtg
tttgacctacaccagaacatggggagtgtcaatgtaagcgtaggctgtacaccagcccaa
ctcatcgagacctcaagggccacggctcagaaggtttcccgccgtagtcgacaacccagc
caggaccttgcctgcacgacaccctggctccctgggactattcaggatgcataccagttt
gggggacccctgcccagttacctacagtttgtgggtatctctccgtcccacaggaatagg
ctccacctctccatgcttgtccgtccacatgcggcttcccagggcctcctgctctctaca
gcccccatgtcgggccgcagcccttcgttggtactctttctaaaccatggacactttgtc
gcacagactgagggccctgggccccggctccaggtccagagtcgccagcactcacgggct
ggccagtggcacagggtgtccgtccgctggggaatgcagcagatccagcttgtggtggac
ggcagccagacctggagccagaaggctctccaccatcgggtccccagggcagagcgacca
cagccctacaccctctctgtaggaggtcttcctgccagcagttacagttccaagctccct
gtgtctgtggggttcagcggctgtctgaagaaattacagctggataagcggccactgagg
accccaacgcaaatggtgggggtcacaccctgtgtctcaggccccctggaagatggcctg
ttcttcccaggcagtgagggagttgtcacattagagctccccaaggccaagatgccctat
gtgagcctggagctagagatgcggcccttggcagctgctggcctcatcttccacctgggc
caggccctggccactccctacatgcagctgaaggtgctgacagaacaggtcctgctgcag
gcaaatgatggggcaggggagttttccacgtgggtgacctaccccaagctttgtgatgga
cggtggcaccgagtggcagtgatcatgggcagggacacactccggctggaggtagacaca
cagagcaaccacaccacaggccgtttgccagagagcttggctggttctccagcacttctg
cacctcgggagcctgcccaagtcttcaactgctcggccagagctccctgcctaccgagga
tgcttgaggaagctgctgatcaatggggcccctgtcaacgtgactgcttctgtacaaatc
cagggggcagtggggatgcgcggatgcccctcaggaaccctagcactttccaagcaggga
aaggcactgacccagaggcaggccaagcccagtgtctccccgctactttggcattga

KEGG   Mus musculus (mouse): 16777Help
Entry
16777             CDS       T01002                                 

Gene name
Lamb1, C77966, C80098, C81607, D130003D08Rik, Lamb-1, Lamb1-1
Definition
(RefSeq) laminin B1
  KO
K05636  laminin, beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16777 (Lamb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16777 (Lamb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16777 (Lamb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16777 (Lamb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16777 (Lamb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16777 (Lamb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16777 (Lamb1)
   05145 Toxoplasmosis
    16777 (Lamb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C HU-CCDC81_bac_2
Motif
Other DBs
NCBI-GeneID: 16777
NCBI-ProteinID: NP_032508
MGI: 96743
Ensembl: ENSMUSG00000002900
Vega: OTTMUSG00000035464
UniProt: E9QN70 Q3UHL7
LinkDB All DBs
Structure
PDB: 

Position
12 A2; 12 13.39 cM
AA seq 1834 aa AA seqDB search
MEGPLSSLPTFAFSPRYLSRKEDPKKRQAACLLRPPSRAASPRLRGLDMGLLQVFAFGVL
ALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQE
DKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFH
FTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDS
RYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRM
EIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELC
MDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGR
NCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHV
EGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQ
CLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTL
DHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEI
LIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCF
EKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWE
TFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQC
QCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCD
RCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGD
HCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGS
CQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNY
LGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCNCNAAHSF
GPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCV
CVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGV
IGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLT
DTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQMSLEAE
KRVNASTTDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDELAGKLQSLDLSA
VAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVL
SALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLT
EDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAE
LLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIES
ETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNADDVKKTLDG
ELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQK
YLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL
NT seq 5505 nt NT seq  +upstreamnt  +downstreamnt
atggaagggcccctctcctctctcccaacatttgccttttctccccgctacctctccaga
aaggaagacccgaagaaaagacaggcagcttgcctgctgcgtcctccttcccgtgccgcg
tcccctcgtctgcgaggactggacatggggctgctccaggtgttcgcctttggtgtccta
gccctatggggcacccgagtgtgcgctcaggaaccggagttcagctatggctgcgcagaa
ggcagctgctaccctgccactggcgaccttctcatcggccgagcgcaaaagctctccgtg
acttcgacatgtggactgcacaaaccagagccctactgtattgttagccacctgcaggag
gacaagaaatgcttcatatgtgactcccgagacccttatcacgagaccctcaaccccgac
agccatctcattgagaacgtggtcaccacatttgctccaaaccgccttaagatctggtgg
caatcggaaaatggtgtggagaacgtgaccatccaactggacctggaagcagaattccat
ttcactcatctcatcatgaccttcaagacattccgcccagccgccatgctgatcgagcgg
tcttctgactttgggaaggcttggggcgtgtacagatacttcgcctacgactgtgagagc
tcgttcccaggcatttcaactggacccatgaagaaagtggatgacatcatctgtgactct
cgatattctgacattgagccctcgacagaaggagaggtaatatttcgtgctttagatcct
gctttcaaaattgaagacccttatagtccaaggatacagaatctattaaaaatcaccaac
ttgagaatcaagtttgtgaaactgcacaccttgggggataaccttttggactccagaatg
gaaatccgagagaagtactattacgctgtttatgatatggtggttcgagggaactgcttc
tgctatggccacgccagtgaatgcgcccctgtggatggagtcaatgaagaagtggaagga
atggttcacgggcactgcatgtgcagacacaacaccaaaggcctgaactgtgagctgtgc
atggatttctaccacgatttgccgtggagacctgctgaaggccggaacagcaacgcctgc
aaaaaatgtaactgcaatgaacattccagctcgtgtcactttgacatggcagtcttcctg
gctactggcaacgtcagcgggggagtgtgtgataactgtcagcacaacaccatggggcgc
aactgtgaacagtgcaaaccgttctacttccagcaccctgagagggacatccgggacccc
aatctctgtgaaccatgtacctgtgacccagctggttctgagaatggcgggatctgtgat
gggtacactgatttttctgtgggtctcattgctggtcagtgtcggtgcaaattgcacgtg
gagggagagcgctgtgatgtttgtaaagaaggcttctacgacttaagtgctgaagacccg
tatggttgtaaatcatgtgcttgcaatcctctgggaacaattcctggtgggaatccttgt
gattctgagactggctactgctactgtaagcgcctggtgacaggacagcgctgtgaccag
tgcctgccgcagcactggggtttaagcaatgatttggatgggtgtcgaccttgtgactgt
gaccttggaggggcgctgaacaatagctgctccgaggactccggccagtgctcctgcctg
ccccacatgattgggcggcagtgtaacgaggtggagtccggttactacttcaccaccctg
gaccactacatctacgaagccgaggaagccaatctggggcctggagtcattgtggtggaa
aggcagtacattcaggaccgcattccttcctggacaggacctgggttcgtccgggtgcct
gaaggggcttatttggagtttttcattgacaacataccgtattccatggagtatgaaatc
ctgattcgctatgagccacagctgccggaccactgggagaaagctgtcatcactgtacag
cggccggggaagattccagccagcagccgatgtggtaacaccgttcccgatgatgacaac
caggtggtgtccttgtcaccgggctcaagatacgttgtcctccctcgccccgtgtgcttt
gagaagggaatgaactacacggtgaggttggagctgccccagtatacggcatcgggcagt
gacgtggagagcccttacacgttcatcgactcgcttgttctcatgccctactgtaaatcg
ctggacatcttcactgttggcggctcaggcgatggggaggtcaccaatagtgcctgggaa
accttccagcgctacaggtgtctggagaacagcaggagtgtggtaaaaacacccatgaca
gatgtctgcagaaacattatcttcagcatttctgccttgattcaccagacgggccttgct
tgtgaatgtgacccccagggatctctgagttctgtgtgtgaccccaatggtggccagtgc
cagtgccgtcctaatgtggttggaagaacctgcaacaggtgtgccccgggcacctttggc
tttggccccaacggatgcaaaccttgtgactgccatctgcaagggtctgccagtgccttc
tgcgatgcgatcactggccagtgccactgtttccagggcatctatgctcggcagtgtgac
cgatgtctccctgggtattggggctttcccagctgccagccctgccagtgtaatggtcat
gctctagactgtgacacagtgacaggggagtgtctgagctgtcaggactacaccacgggc
cacaactgcgaaaggtgcctggctggctactacggtgatcccatcattgggtcaggagac
cactgtcgcccttgcccttgtcctgatggtcctgacagtggacgacagtttgccaggagc
tgttatcaagaccccgtcactctccagcttgcgtgtgtttgtgatcctgggtacattggc
tccagatgtgatgactgtgcctctggattttttggcaatccctcagactttgggggttca
tgtcaaccatgtcagtgccaccacaacattgacactaccgatccagaagcctgtgacaag
gagacgggacgatgcctcaagtgcctgtaccacacagaaggggaccattgccagctctgc
cagtatgggtactacggcgatgctcttcggcaagactgtagaaagtgtgtctgcaattac
ctgggcacggtgaaggaacattgtaatggctctgactgccactgtgacaaagccactggt
cagtgctcgtgccttcccaatgtgatcgggcagaactgtgaccggtgtgcgcccaacacc
tggcagctggctagcgggactggctgcgggccctgcaattgcaatgctgcgcattccttt
gggccatcctgcaacgagttcacagggcagtgccagtgcatgccgggctttggaggccga
acctgcagcgagtgccaggagctcttctggggagaccctgatgtggaatgccgagcctgt
gactgtgatcccaggggcattgagacacctcagtgtgaccagtccacgggccagtgtgtc
tgtgtggagggtgtagagggtcctcgctgcgacaagtgcaccagaggttactcgggggtc
tttcctgactgcacaccctgccaccagtgctttgctctctgggatgctatcattggtgag
ctgaccaacaggacccacaaattcctggagaaagccaaggctctgaaaatcagtggtgtg
attggtccctaccgagagaccgtggactctgtagagaagaaagtcaatgagataaaagac
atcctggcccagagcccagcagcggaaccactgaaaaacattggcattctcttcgaggag
gcagagaaactaaccaaagatgtcacagaaaagatggcgcaggtagaagtgaaattaact
gatacagcttcacagagtaacagcacagctggagagctcggcgcactgcaggcagaagca
gagagccttgacaagaccgtgaaggagctggcagaacagctggagtttatcaaaaactcc
gatattcagggcgccttggatagcatcaccaagtatttccagatgtctcttgaggcagag
aagcgggtgaatgcctccaccacagaccccaacagcactgtggagcagtctgccctcacg
cgagacagagtagaagatctgatgttggagcgagagtctccgttcaaggagcagcaggag
gaacaggcacgcctcctggacgaactggccggcaaactgcaaagtctcgacctgtcggct
gttgcacagatgacctgtggaacacctccaggggctgactgttctgaaagtgaatgtggt
ggccccaactgcagaactgacgaaggagagaagaagtgtggggggcctggctgtggtggt
ctggtcactgtggcccacagtgcttggcagaaagccatggattttgaccgtgatgtcctg
agtgccctggctgaagtcgaacagctctccaagatggtctctgaagcaaaagtgagagca
gatgaggcgaagcagaatgcgcaggatgtcctgttaaaaacaaatgctaccaaagaaaaa
gtggacaagagcaacgaggacctgcggaacctcatcaagcagatcagaaacttcctgact
gaggatagtgctgatctagacagtattgaagcagttgctaatgaagtactgaaaatggaa
atgcctagcacgccacagcagttacagaacctaacagaagacattcgggagcgagttgaa
accctctctcaagtagaggttattttgcagcagagtgcagctgacattgccagagctgag
ctgttgcttgaggaagctaagagagcaagcaaaagtgcaacagatgttaaagtcactgca
gacatggtgaaggaagcattagaagaagcagaaaaggcccaggttgcagcagagaaggcg
attaaacaagctgatgaggatatccaaggaacccaaaacctgctaacatcgattgaatct
gaaacggcagcttctgaggaaaccctgaccaacgcctcccagcgcatcagcaagcttgag
aggaacgtggaagagcttaagcgtaaagctgcccagaactctggggaggcagaatatatc
gaaaaagtagtatattctgtaaaacagaatgcagacgatgttaagaagactctagatggc
gaacttgatgaaaagtataagaaggtagaaagtttaattgcccaaaaaactgaagagtca
gcagatgccaggaggaaagctgagctgctacaaaatgaagcaaaaacactcttggctcaa
gctaacagcaagctccagctgttggaagacttagaaagaaaatatgaggacaatcaaaaa
tacttagaagataaagctcaagaattggtgcgactggaaggagaggttcgctccctcctt
aaggacataagtgagaaagttgcggtttacagcacctgcttataa

KEGG   Mus musculus (mouse): 16779Help
Entry
16779             CDS       T01002                                 

Gene name
Lamb2, AW211941, Lamb-2, Lams, npht
Definition
(RefSeq) laminin, beta 2
  KO
K06243  laminin, beta 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16779 (Lamb2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16779 (Lamb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16779 (Lamb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16779 (Lamb2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16779 (Lamb2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16779 (Lamb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16779 (Lamb2)
   05145 Toxoplasmosis
    16779 (Lamb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 16779
NCBI-ProteinID: NP_032509
MGI: 99916
Ensembl: ENSMUSG00000052911
Vega: OTTMUSG00000050824
UniProt: Q61292 Q3USI2
LinkDB All DBs
Position
9 F2; 9 59.4 cM
AA seq 1799 aa AA seqDB search
MEWASGEPGRGRQGQPLPWELRLGLLLSVLAATLAQAPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHTHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRDPTKDMRDPAVCRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASDPRGCQRCQCNSRGT
VPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEAAQGQGLEVVERLVTNRETPSWTGP
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELMVQRPGPVSAHSPCGHV
LPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKLKLKLIGTGGRAQPETSYSGLLIDSLV
LQPHVLVLEMFSGGDAAALERRTTFERYRCHEEGLMPSKAPLSETCAPLLISVSALIYNG
ALPCQCDPQGSLSSECSPHGGQCRCKPGVVGRRCDVCATGYYGFGPAGCQACQCSPDGAL
SALCEGTSGQCPCRPGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGACLGCRDY
TGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCQCREG
YTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHNTEGPHC
GYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHC
APNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQ
CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDR
VVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNMQGKLGMVQAIMSARNASAASTAKLV
EATEGLRHEIGKTTERLTQLEAELTAVQDENFNANHALSGLERDGLALNLTLRQLDQHLE
ILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENF
NRQHLANQQALGRLSAHAHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGG
LGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKAN
ASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEI
AERVRSLADVDTILAHTMGDVRRAEQLLQDAHRARSRAEGERQKAETVQAALEEAQRAQG
AAQGAIWGAVVDTQNTEQTLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSL
AASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEAR
DLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5400 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggcctcaggagaaccagggaggggcaggcagggacagcctttgccatgggaa
cttcgcttgggcctacttctaagtgtgctggctgccacattggcccaggccccgtccttg
gatgtacctggctgttctcgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcggacagactgacggcctcatccacgtgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggacgaaaagaagtgtttcctgtgtgactcccgacgtcccttc
tctgctcgagacaacccaaatagtcatcggatccagaatgtagtcaccagctttgcgcca
caacgccggacagcctggtggcaatcggagaacggggttccaatggtcaccatccaactg
gacctggaagctgagtttcatttcacccacctcattatgacgttcaagacgttccggcct
gctgctatgctggtggagcgttctgcagactttggccgcacctggcacgtgtaccgatat
ttttcctatgactgcggggctgacttcccgggaatcccactggccccgccacgtcgctgg
gatgatgtagtgtgtgagtcccgctactcagaaatcgagccgtctacggaaggcgaggtc
atctatcgtgtgctggaccctgctattcctatcccagacccctacagctcacggattcag
aacctgttgaagatcaccaacctacgagtgaacttaacccggcttcacacactgggagac
aacttgcttgacccacggagggagatccgggaaaaatactattatgctctctatgaactt
gtcatccgtggcaactgcttctgctatggccacgcctcacagtgtgcgcctgcaccaggg
gcgccggcccatgctgagggcatggtacacggagcctgtatctgcaagcacaatactcgt
ggactcaactgtgagcagtgtcaggatttctatcaggaccttccctggcaccctgcagag
gacggccatactcacgcctgtcggaagtgtgagtgcaacgggcatactcatagctgccac
tttgacatggctgtctacctggcatctggaaatgtaagtggaggcgtatgcgatgggtgt
cagcacaacacagctgggcgccattgtgagttctgccggcccttcttctaccgtgacccc
accaaggacatgcgggacccagctgtgtgccgtccttgtgactgtgaccctatgggttct
caagatggtggtcgctgtgattctcatgatgaccctgtgctaggactggtctcaggccag
tgtcgctgcaaagaacacgtggttggcactcgctgccagcaatgccgtgatggcttcttt
ggacttagtgccagtgaccctcgagggtgccagcgttgccagtgtaattcacggggcaca
gtgcctgggagctccccttgtgactccagtagtggaacctgtttctgcaagcgtctggtg
accggacatggctgtgaccgctgtctgcctggccactggggcctgagccatgacctgctg
ggctgccgtccctgtgactgtgatgtgggcggtgccttggatcctcagtgtgatgaggcc
accggtcagtgccgctgccgccaacacatgattgggcggcgctgcgaacaagtgcagcct
ggctacttccggccttttctggaccatttaacctgggaggctgaggctgcccaagggcag
gggcttgaggtggtagagcggctggtgaccaaccgagagactccgtcctggactggccca
ggctttgtgcggctgcgagaaggtcaggaagtggagttcctggtgacctctttgcctagg
gccatggactatgacctgctactgcgctgggagccccaggtccctgagcaatgggcagag
ctggaactgatggtgcagcgtccggggcctgtgtctgctcacagtccgtgcgggcatgtg
ctgcctaaggatgaccgcattcaggggatgcttcacccaaacaccaggtttttggtgttt
cccagacctgtctgccttgagcctggcatctcctacaagctgaagctgaaactgatcgga
acagggggacgagcccagcctgaaacctcctactctggattactcattgactcgctggtc
ctgcagccccacgtcttggtgctagagatgtttagtgggggcgatgctgctgctctggag
cgccgtaccacctttgaacgctaccgctgccatgaggaaggtctgatgcccagcaaggcc
cctctatctgagacctgtgcccccctcctcatcagcgtgtccgccttgatctacaatggc
gccttgccatgtcagtgtgaccctcaaggctcactgagttctgaatgcagtcctcacggt
ggccagtgccggtgcaaacctggagtggttggacgccgttgtgatgtctgtgctactggc
tactatggctttggccctgcaggctgtcaagcctgccagtgtagtcctgatggagcactc
agtgccctctgtgaagggactagtggacagtgcccctgccgacctggtgcctttggtctt
cgctgtgaccactgtcaacgtggccagtggggattccctaattgccggccgtgtgtctgc
aatgggcgtgcggatgagtgtgatacccacacaggcgcttgcctgggctgccgtgattac
acggggggcgagcactgtgaaaggtgcattgctggttttcatggggacccacggctgcca
tatgggggccagtgccggccttgtccctgccctgaaggccctgggagccagcgacacttt
gctacttcttgccaccgggatggatattcccagcaaattgtgtgccagtgtcgagaaggc
tacacagggcttcggtgtgaagcttgtgcccccgggcactttggggacccatcaaagcca
ggtggcaggtgccaactgtgtgagtgcagtggaaacattgatcccatggaccctgatgcc
tgtgatccccacacggggcaatgcttgcgttgtttacacaacacagaggggccccactgt
ggctattgcaagcctggcttccatgggcaagctgcccgacagagctgtcaccgctgtacc
tgcaaccttctgggcacagatcccaggcggtgcccatctaccgacctgtgccattgtgac
ccaagcactgggcagtgcccatgccttccccatgtccaaggcctcaactgtgaccattgt
gcccccaacttttggaacttcaccagtggccgtggctgccagccttgtgcttgtcaccca
agccgggccagaggccctacctgcaatgagttcacagggcagtgtcactgtcatgctggc
tttggtgggaggacttgttctgagtgccaagagctctactggggagaccctggtctgcag
tgccgtgcctgtgactgtgatcctagaggaatagacaaacctcagtgtcatcgttccaca
ggccactgtagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgctcgtggc
ttctcaggggtttttcctgcttgtcacccctgccacgcttgctttggagactgggatcgt
gtggtacaggacctggctgctcggacgcggcgcctggagcagtgggctcaggagttgcag
caaacaggagtgctgggtgcctttgagagcagctttttgaacatgcaggggaagctaggc
atggtgcaggccattatgagtgcccgcaatgcctcagccgcctctacggcgaagcttgta
gaggccacagagggactacgtcatgaaatcgggaagaccaccgagcgcctgactcagtta
gaagcagagctaacagctgtgcaggatgagaacttcaatgccaaccatgcactcagtggt
ctggagagagacgggcttgcgcttaatctcaccctgaggcagctggatcagcatctggag
atcctcaaacattcaaatttcttaggtgcctatgacagcatccgacatgcccacagccag
tccacagaggcagagcgccgtgccaacgcctccacctttgcagtacccagccctgtgagc
aactcagcagatacccggcgtcggacggaagtgctaatgggtgcccaaaaagaaaacttc
aaccgccaacatttggccaaccagcaggcactgggacggctctctgcacatgcccacacc
ctgagcctgacgggcataaatgagttggtgtgtggggcaccaggggacgcaccctgtgcc
accagcccttgtgggggtgccggatgtcgggatgaagatgggcagccccgttgtggtggc
ctcggttgcagtggggcagcagccacggcagatctagcgctgggccgggctcggcacacg
caggcagagctgcagcgggcactggtagaaggtggcggcatcctcagccgggtgtctgag
actcgtcggcaggcagaagaggcacagcagcgagcacaggcagccctggacaaggctaat
gcttccaggggccaggtggaacaggccaatcaggagcttcgagaacttatccagaatgtg
aaagacttcctcagccaggagggagccgatcctgacagtattgaaatggtagcgactcgg
gtgctagacatctccatcccggcctcacccgagcagatccagcgcctagccagtgagatt
gcagaacgcgtccgaagcctggccgacgtggacacaatcctggcccataccatgggcgac
gtgcgtcgggctgaacagctactgcaagatgcgcaccgggcacggagccgggccgagggt
gagagacagaaggcagagacagtccaagcggcactggaggaggctcagagggcacaagga
gctgctcagggtgccatctggggagcagtggttgacacacaaaacacagagcagaccctg
cagcgggtccaggagaggatggcaggtgcagagaagtctctgaactctgccggtgagcgg
gctcggcaattagacgccctcctggaggccctgaaactgaaacgggcaggaaatagcctg
gcagcatctacagcggaagaaacagcaggcagtgcccagagccgtgccagggaggctgag
aaacaactacgggaacaagtaggtgaccaataccaaacagtgagggcgttggcagagcgg
aaggctgaaggtgttctggctgcacaagccagggcagaacaactgcgggatgaggctcgg
gacctgttgcaggccgctcaggataagctgcagcggctacaggagctggagggcacatat
gaggagaacgagcgtgcactggagggcaaagcggcccagctggatgggctggaagccagg
atgcgcagtgtgctccaggccatcaacttgcaggtccagatctacaacacctgccagtga

KEGG   Mus musculus (mouse): 16780Help
Entry
16780             CDS       T01002                                 

Gene name
Lamb3
Definition
(RefSeq) laminin, beta 3
  KO
K06244  laminin, beta 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16780 (Lamb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16780 (Lamb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16780 (Lamb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16780 (Lamb3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16780 (Lamb3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16780 (Lamb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16780 (Lamb3)
   05145 Toxoplasmosis
    16780 (Lamb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II F5_F8_type_C BNR_6 Tocopherol_cycl
Motif
Other DBs
NCBI-GeneID: 16780
NCBI-ProteinID: NP_001264857
MGI: 99915
Ensembl: ENSMUSG00000026639
Vega: OTTMUSG00000025453
UniProt: Q61087
LinkDB All DBs
Position
1 H6; 1 97.71 cM
AA seq 1168 aa AA seqDB search
MTAFFLLWLALPGFLCAQQACSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYCTQYG
QWQMKCCKCDSRLPRNYNSHRVENVASSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDIM
MDFKGLTPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQRP
NGHLTGGKVQLNLMDLASAIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYFA
VSQLRLQGSCFCHGHADRCAPNPGGSTTAVQVNNVCVCQHNTAGPNCDRCAPFYNNRPWR
PAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNGGVCDNCRDHTEGKNCERCQLHYF
RNRRPSAPIHETCIPCECDPDGAVQGAPCDRLTGQCVCKEYVQGERCDLCKPGFTGLTFA
NPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASGLGCEPCAC
DPRNSLSSQCNQFTGQCPCREGFGGLTCSSAAIRQCPDQTYGHVATGCRACDCDFRGTEG
PGCDKASGRCLCRPGFTGPRCDQCQRGHCDRYPVCVACHSCFQAYDTDLQEQARRLHSLR
NATEGLWTGTGLEDHGLASRLLDAKSKIEQIRQILEGTSVTEQDVAQVANGILSIRRTLQ
GLPLDLPLEEEMESFSGDLGNLDRSFSRLLLMYRSKKEQFEKLSSEDPSGAFRMLTMAYE
QSSRAAQQVSDSSSLLSQLRDSRREAEGLERQAGGGGTGGAQLMALRLEMASLPDLTPTI
NKLCGRSRQTACTPGDCPGELCPQDNGTACGSHCRGALPRAKGAFHMAGRVAEQLRNFNT
QLQQTRQMIRAAEEAASRVQADAQRLETQVSTSRLLMEEDVQRTRLLIQQVRGFLTDPDT
DAATIQQVSEAVLALWLPTDSATVLRKMKEIQAIAARLPNVDSVLSQTKQDIARARRLQA
EAEQARSRAHAVEGQVDDVVGNLRQGTVALQEAQDTMQGTGRSLRLIQERVGEVQQVLVP
AERLVKGMKEQMSGFWARMKELRRQAQEEQAQAMQARQLAEGASQQAMNAQEGFKRLKQK
YTELKDRLGQSPVLGEQGNRILSIKMEAEELFGETMEMMDKMKDMESELLRGSQAIMLRS
ADLSGLEKRVEQIRSYINGRVLYYATCK
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatttttcctcctgtggcttgccttgcctggcttcctgtgtgcccagcaagcc
tgctcccgaggggcctgttatccacctgtgggggacttgctcattggaaggactcagctt
cttcgagcctcatctacctgtggattgaccaaacctgagacctattgcacccaatatgga
cagtggcagatgaaatgctgcaagtgtgactccaggctgcctcgaaattacaacagtcac
cgagtggagaatgtcgcatcgtcttcaggccccatgcgctggtggcagtcacagaatgat
gtgagccctgtctctctgcagctggacctagacaagaggatgcagcttcaggacatcatg
atggattttaagggtctcacaccagctggcatgttgattgagcgctcttctgactttggc
aagacatggagggtgtaccagtacctggcgacagactgtgccagcacctttccccaggtc
caccagggccagcccaagaactggcaggacgtccggtgccggcccttgtcccagaggcct
aatgggcatctgactgggggaaaggtccaacttaaccttatggatttagcatcagctatc
cctgcatctcaaagtaaaaagattcaagaacttggggacatcacaaacttgagagtcaac
ttcaccaagctggcccctgtgccccagaggggctcctatccacccagcgcctactttgca
gtgtcacagctacgtctacaggggagttgcttctgtcacggacatgccgaccgctgtgcc
cctaatcctggaggttctaccactgctgtgcaggtcaacaatgtctgtgtctgccagcat
aacacagctggccccaattgtgaccgctgtgcccctttctacaacaaccgtccatggaga
cctgcagagggccaggacacccacgagtgccaaaggtgtgactgcaatgggcactcagag
acctgccacttcgacccagctgtgtttgctgccagccaggggacaaatggaggtgtgtgt
gacaactgccgggaccacaccgagggcaagaactgcgagcgctgtcagctacactatttc
cggaatagacgacccagcgctcccattcatgagacttgtattccctgtgagtgtgatcca
gatggagcagtccagggagctccctgtgaccgactgacgggccagtgtgtgtgcaaagag
tacgtgcaaggagagcgctgcgacctttgcaagcctggcttcaccgggctcaccttcgcc
aacccgaagggctgccatgcctgtgactgcagtatcttaggtgcccggaaagatatgcct
tgtgaggaggaaaccggacgctgcttgtgtctgcccaatgtagtgggccccaaatgtgac
cagtgtgccccttcccactggaagctggccagcggcctgggctgcgagccctgtgcctgt
gaccctcgcaactccctaagctcccagtgcaaccagtttacaggacagtgtccttgtcgg
gaagggtttggcggcctcacgtgtagttctgcagccatccgccagtgtcctgaccagacc
tatggacacgtggccacagggtgccgagcttgtgactgtgacttcagaggaacagagggt
cctggctgtgacaaagcctcaggccgttgcctctgccgccctggctttaccgggccccgc
tgtgaccaatgccaacgaggtcactgtgaccgctacccagtatgtgtggcctgccactcc
tgcttccaggcctatgacacagacctccaggagcaagctcgacgccttcacagtctccgt
aatgccaccgaaggcctgtggacagggacaggtctggaagaccatggcctggcttctcgg
ttgctagatgccaagagcaagattgagcagatcagacagattctggaaggcacttctgtc
acagagcaggatgtggctcaggtggccaatggcatcttgtctatcaggagaactcttcag
ggcctgccgctggacctgcccttagaggaggagatggaatccttctctggagacctgggg
aatctagacagaagcttcagtcggctcctccttatgtaccgaagcaagaaggagcaattt
gagaagctaagcagtgaagacccttcaggagccttccgcatgctgaccatggcttatgag
cagtcctcccgggctgcacagcaagtgtctgacagttctagcctgctgagccagttgagg
gacagtcgcagggaagcagagggcctggagagacaggctggaggaggaggcaccggagga
gctcagctcatggccctgcgcctagaaatggcttcgctgcctgacttgacacccaccatc
aacaagctttgtggcaggtctaggcagacagcctgtactccaggagattgccctggagag
ctgtgtcctcaggacaatggtacagcttgtggctctcactgcaggggagccctgcccaga
gccaaaggggccttccacatggcagggcgggtagctgagcagctacgaaacttcaacacc
cagctccagcagaccaggcaaatgatcagggcagccgaggaagcagcatcaagggtccaa
gccgatgcccagcgccttgagacccaggtgagtaccagccgcttgctgatggaggaagat
gtccagcgcacacggcttctcatccaacaggtccggggctttctcacagatcctgacaca
gatgcagccaccatccaacaggtcagcgaggcagtgctggctctctggctgcccacagac
tcagccacagtgctgcgcaagatgaaagagatccaggccattgcggccaggctccctaat
gtggactcagtgctatcccagaccaaacaagacatcgcacgggcccgcaggctccaggct
gaggctgagcaggccagaagccgagcccacgctgtggaagggcaggtagatgatgtggtc
gggaaccttcggcagggcaccgtggctctgcaggaagctcaggacacaatgcagggtact
ggccgctctcttcggctcatccaggaaagggttggtgaggttcagcaggtccttgtacca
gctgaaaggctggtgaaaggcatgaaggaacagatgagtggattctgggcacggatgaag
gagcttcgccgtcaggcccaggaggagcaggcccaggcaatgcaggcccggcagcttgca
gagggtgccagccagcaggcaatgaatgcccaggagggctttaagagacttaagcaaaag
tatacagagttgaaggaccggctgggtcagagtcctgtgctgggcgagcaaggcaatcga
atcctgagcatcaagatggaggcagaggagctctttggggagaccatggaaatgatggac
aaaatgaaagacatggagtcagagctgcttcgagggagtcaggctatcatgctgcgctct
gcagacctgtcggggctggagaagcgtgtggagcagatccgcagttacatcaatgggcga
gtgctctactatgccacctgcaagtga

KEGG   Mus musculus (mouse): 16782Help
Entry
16782             CDS       T01002                                 

Gene name
Lamc2, AA589349
Definition
(RefSeq) laminin, gamma 2
  KO
K06246  laminin, gamma 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16782 (Lamc2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16782 (Lamc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16782 (Lamc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16782 (Lamc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16782 (Lamc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16782 (Lamc2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16782 (Lamc2)
   05145 Toxoplasmosis
    16782 (Lamc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_B
Motif
Other DBs
NCBI-GeneID: 16782
NCBI-ProteinID: NP_032511
MGI: 99913
Ensembl: ENSMUSG00000026479
Vega: OTTMUSG00000049711
UniProt: G5E874
LinkDB All DBs
Position
1 G3; 1 65.26 cM
AA seq 1193 aa AA seqDB search
MPALWLSCCLGVALLLPAAQATSRREVCDCNGKSRQCVFDQELHRQTGSGFRCLNCNDNT
AGVHCERCREGFYRHRDRDRCLPCNCHSKGSLSAGCDNSGQCRCKPGVTGQRCDRCQPGF
HMLTDAGCTRDQGQLDSKCDCDPAGISGPCDSGRCVCKPAVTGERCDRCRPGYYHLDRAN
PEGCTQCFCYGHSASCHASADFSVHKITSTFSQDVDGWKAVQRNGAPAKLHWSQRHRDVF
SSARRSDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRQPSAYDVILEGAGLQIRAPL
MAPGKTLPCGITKTYTFRLNEHPSSHWSPQLSYFEYRRLLRNLTALLIRATYGEYSTGYI
DNVTLVSARPVSGAPAPWVERCVCPAGYKGQFCQECASGYKRDSARLGPFGACVPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGFFGDPFGERGPVRPCQRCQCNNNVDPNASGNCDQLTGRCLK
CIYNTAGVYCDQCKAGYFGDPLAPNPADKCRACNCSPMGSEPGECRGDGSCVCKPGFGGL
NCDHAALTSCPACYNQVKIQMDQFTQQLQSLEALVSKAQGGGGGGTVPSGELEGRMQQAE
QALRDILREAQISEGAMRALGFRLAKARSQENDYKTRLDDLKMTAERIRALGSQHQNRVQ
DTSRLISQMRLSLAGSEASLQNTNIHSSEHYVGPNGFKSLAQEATRLADSHAESANAMKQ
LARETEDYSKQALSLARKALSGGGGSGVLDSSVVQGLMGKLEKTKSLSQQLSREGTQADI
EADRSYQHSLRLLDSASQLQGVSDLSFQVEAKRIRQKADSLSNLVTRQTDAFTRVRNNLG
NWEKETRQLLQTGKDRRQTSDQLLSRANLAKNRAQEALSMGNATFYEVENILKNLREFDL
QVEDRKAEAEEAMKRLSSISQKVADASDKTQQAETALGSATADTQRAKNAAREALEISSE
IEQEIGSLNLEANVTADGALAMEKGLATLKSEMREMEGELARKELEFDTDKDTVQLVITE
AQQADARATSAGVTIQDTLNTLDGILHLIDQPGSVDEEGMMLLEQGLFQAKTQINSRLRP
LMSDLEERVRRQRNHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgctctggctcagctgctgccttggtgtcgcgctcctgctgcccgcagcccag
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcaatgtgtctttgat
caggagctccatcgacagacaggcagcgggttccgttgcctcaactgcaatgacaataca
gcgggggttcactgcgagcggtgcagggaggggttttaccgacatcgagacagagaccgc
tgcctaccctgcaactgccactcaaagggttccctcagtgctggatgtgacaactctgga
caatgcaggtgtaagccaggtgtgacaggacaaagatgtgaccgatgtcagccaggcttc
catatgctcaccgatgctggatgcacccgagaccaggggcaactagattccaagtgtgac
tgtgacccagctggcatctctggaccctgtgattctggccgatgtgtctgcaaaccagcc
gtcactggagagcgctgtgataggtgccgaccaggctactatcatctggaccgggcaaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccacgcctctgcc
gacttcagtgtccacaaaatcacttcaactttcagtcaggatgtggatggttggaaggcg
gttcagagaaacggggcacctgcaaaactccactggtcacagcgccatcgggacgtgttt
agttctgcccgaagatcagaccccgtctatttcgtggcccctgccaaattcctcggtaac
cagcaagtgagttacgggcagagcctgtcttttgactaccgcgtggacagaggaggtaga
cagccgtctgcctacgatgtgatcctggaaggtgctggtctacagatcagagctcctctg
atggctccaggcaagacacttccctgtgggatcacaaagacttacacattcagactgaat
gaacatccaagcagtcactggagtccccagctgagttatttcgaatatcgaaggttactg
cggaacctcacagccctcctgatccgagctacgtacggagaatatagtacagggtacatt
gataacgtgaccctggtttcagcccgccctgtctctggagccccagccccttgggttgaa
cgttgtgtatgccctgctgggtacaagggacaattctgccaggaatgtgcttctggttac
aaaagagattcggcaagattggggccttttggcgcctgtgttccctgtaactgccaaggg
ggaggggcctgtgatccagacacgggagattgctactcgggggacgagaatcctgacatt
gagtgtgctgactgtcccatcggtttctacaatgacccacatgacccccgcagctgcaag
ccatgtccctgtcacaatgggttcagctgttcagtgatgcctgagacagaggaggtggtg
tgtaacaactgtccccctggggtcacaggtgcccgctgtgagctctgtgctgatggcttc
tttggggatccctttggggaacgtggcccagtgaggccttgtcaacgctgccaatgcaac
aacaacgtggaccccaatgcctctgggaactgtgaccagttgacaggcagatgcttgaaa
tgtatctacaacacggccggtgtctactgtgaccagtgcaaagcaggttactttggagac
ccattggctcccaacccagcagacaagtgtcgagcttgcaactgcagccccatgggctcg
gagcctggagagtgtcgaggtgatggcagctgtgtttgcaagccaggctttggcggcctc
aactgtgatcacgcagccctaaccagttgtcctgcttgctacaatcaagtgaagattcag
atggaccagtttacccagcagctccagagcctggaggccctggtttcaaaggctcagggt
ggtggtggtggtggtacagtccccagtggggagctggaaggcaggatgcagcaggctgag
caggcccttcgagacattctaagagaagctcagatttcagaaggggcaatgagagccctt
ggcttccggctggccaaggcaaggagccaagagaacgactacaagacccgcctggatgac
ctcaagatgactgcagaaaggatccgggccctgggcagtcagcatcagaacagagttcag
gatacgagcagactcatctctcagatgcgcctgagtctggcaggaagcgaagcttccctg
caaaacactaatatccattcttctgagcactacgtggggccgaatggatttaaaagtctg
gctcaggaggctacaagattggcagacagccacgctgagtcagctaacgcaatgaagcaa
ctagcaagggaaactgaggactactccaaacaagcactttcattggcccgcaaggctctg
agtggaggaggcggaagtggcgtcttggacagctccgtggtacaaggtcttatgggaaaa
ttagagaaaaccaagtccctgagccagcagctgtcaagggagggcacccaagccgacatt
gaagctgataggtcgtatcagcacagtctccgcctcctggattctgcctctcagcttcag
ggagtcagtgatctgtcctttcaggtggaagcaaagaggatcagacaaaaggctgattct
ctctcaaacctggtgaccagacaaacggatgcattcacgcgtgtgcgaaacaatctgggg
aactgggaaaaagaaacacggcagcttttacagactggaaaggataggagacagacttca
gatcagctgctttcccgtgccaaccttgctaaaaacagagcccaagaagcgctaagtatg
ggcaatgccactttttatgaagttgagaacatcctgaagaacctccgagagtttgatctg
caggttgaagacagaaaagcagaggctgaagaggccatgaagagactctcctctattagc
cagaaggttgcagatgccagtgacaagacccagcaagcagaaacggccctggggagcgcc
actgccgacacccaacgggcaaagaacgcagctagggaggccctggagatcagcagcgag
atagagcaggagatagggagtctgaacttggaagctaatgtgacagcagatggggccttg
gccatggagaagggactggccactctgaagagcgagatgagagagatggagggggagctg
gccagaaaggagctggagtttgacacggataaggacacggtgcagctggtgattactgaa
gcccagcaagctgatgccagagccacgagtgccggagttaccatccaagacacactcaac
acattggacggcatcctacacctcatagaccagcctggcagtgtggatgaagaagggatg
atgctattagaacaagggcttttccaagccaagacccagatcaacagtcgacttcggccc
ttgatgtctgacctggaggagagggtgcgtcggcagaggaaccacctccatctgctggag
accagcatagatggaattctagctgatgtgaagaacctggagaacattcgagacaacctg
cccccaggctgctacaatacccaagctcttgagcaacagtga

KEGG   Mus musculus (mouse): 226519Help
Entry
226519            CDS       T01002                                 

Gene name
Lamc1, Lamb2
Definition
(RefSeq) laminin, gamma 1
  KO
K05635  laminin, gamma 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05020  Prion diseases
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    226519 (Lamc1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    226519 (Lamc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    226519 (Lamc1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    226519 (Lamc1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    226519 (Lamc1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    226519 (Lamc1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    226519 (Lamc1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    226519 (Lamc1)
   05145 Toxoplasmosis
    226519 (Lamc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 226519
NCBI-ProteinID: NP_034813
MGI: 99914
Ensembl: ENSMUSG00000026478
Vega: OTTMUSG00000030992
UniProt: F8VQJ3
LinkDB All DBs
Structure
PDB: 

Position
1 G3; 1 65.3 cM
AA seq 1607 aa AA seqDB search
MTGGGRAALALQPRGRLWPLLAVLAAVAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPVKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDDMVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRSTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFGEVTDLDNEVNGMLRQLEEAENELKKKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLNNLLDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLE
SEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcggcgggcgggccgcgctggccctgcagccccgggggcggctgtggccgctg
ttggctgtgctggcggctgtggcgggctgtgtccgggcggccatggacgagtgcgcggat
gagggcgggcggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccgcccgaggagtactgcgtgcagactggggtg
accggagtcactaagtcctgtcacctgtgcgacgccggccagcagcacctgcaacacggg
gcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgcctcaagttccacaccagccgtccagagagcttcgccatc
tataagcgcactcgggaagacgggccctggattccttatcagtactacagtgggtcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggaccggaggggacgagcagcag
gccttgtgtactgatgaattcagtgacatttcccccctcaccggtggcaacgtggccttt
tcaaccctggaaggacggccgagtgcctacaactttgacaacagccctgtgctccaggaa
tgggtaactgccactgacatcagagtgacgctcaatcgcctgaacacctttggagatgaa
gtgtttaacgaccccaaagttctcaagtcttactattacgcaatctcagactttgctgtg
ggcggcaggtgtaaatgtaacggacatgccagcgagtgtgtaaagaacgagtttgacaaa
ctcatgtgcaactgcaaacataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaatgaccggccgtggaggagggcgactgctgagagcgccagcgagtgccttccttgt
gactgcaatggccgatcccaagagtgctactttgatcctgaactataccgttccactgga
catggtggccactgtaccaactgccgggataacacagatggtgccaagtgcgagaggtgc
cgggagaatttcttccgcctggggaacactgaagcctgctctccgtgccactgcagccct
gttggttctctcagcacacagtgtgacagttacggcagatgcagctgtaagccaggagtg
atgggtgacaagtgtgaccgttgtcagcctgggttccattccctcactgaggcaggatgc
aggccatgctcctgcgatccttcgggcagcacagacgagtgtaatgttgaaacaggaaga
tgcgtttgcaaagacaatgttgaaggcttcaactgtgagagatgcaaacctggatttttt
aatctggagtcatctaatcctaagggctgcacaccctgcttctgctttggccattcttct
gtgtgcacaaatgctgttggctacagtgtttatgacatctcctccacctttcagattgat
gaggatgggtggcgcgtggagcagagagatggctcggaggcgtctctggagtggtcctca
gacaggcaagatattgccgtaatctcagacagttactttcctagatacttcatcgcccct
gtgaagttcctgggcaaccaggtcctgagttatgggcagaatctttccttctccttccga
gtggacagacgagacactcgcctctccgcagaggaccttgtgctcgaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcctaccccagcgagaccactgtgaag
tacatcttcaggctccatgaagcaacggattacccttggaggcccgctctctccccgttt
gaatttcagaagctcctgaacaacttgacctctatcaagatccgtggtacatacagcgag
aggagcgctgggtacttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cctgcaacgtgggtggagtcctgcacctgtccagtgggatacgggggacagttctgtgag
acgtgcctcccagggtacagaagagaaactccaagccttggaccttatagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgacccggagacaggtgtctgtgactgc
agagacaatacagccggcccccactgtgagaaatgtagcgatgggtactatggggactca
accctgggcacctcctctgactgccagccttgtccctgccccggtggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacgcactgtccgactggcactgccggcaag
agatgtgaactctgtgatgacggctactttggagaccctctgggcagcaatgggcctgtg
agactgtgccgcccgtgccagtgtaacgacaacatagaccccaacgcggttggcaactgc
aaccgcctgacgggcgagtgcctgaagtgcatctataacacggctggtttctactgcgac
cggtgcaaggaagggtttttcggaaatcccctggctcccaatccagccgacaaatgcaaa
gcctgcgcctgcaatccctacgggacagtgcagcaacagagcagctgtaacccggtgacc
ggacagtgccagtgtctgcctcatgtgtctggccgcgactgcggtacttgtgaccctggc
tactacaacctgcagagcgggcaaggctgcgagaggtgtgactgccatgctttgggttcc
accaatgggcagtgtgacatccgcaccgggcagtgtgagtgccagcctggcatcaccggc
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgtgactgtcaccatgaaggatccctttcactccagtgtaaagaggacggccgttgtgaa
tgcagggaaggctttgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcctggcctggctgccaggagtgtccggcttgttaccgactggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttagagagcctcatcgccaaccttggcactggg
gatgacatggtgacagatcaagcctttgaggacagacttaaggaagcagaaagggaggtg
acagaccttctccgtgaggctcaggaagtcaaagatgtagatcaaaatctgatggatcgc
cttcagagagtaaatagcagcctgcatagccaaattagccgactgcagaatatccggaat
actatcgaagagaccgggatcttggctgagcgagcacggtcccgagtggagagtacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggagccaaacaacatgaccctcttggcagaagaa
gcccgaaagcttgcagagcgtcataaacaggaagccgatgacattgtacgagtggcaaag
acagccaacgagacttcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcgctggagattgaagaacttaaccggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgcccgagtccatgaggaagccaagcgtgcaggtgac
aaagccgtagagatctatgccagtgtggcccagctgacccctgtggactctgaggccctg
gagaatgaagcaaataaaatcaagaaagaagctgcagacctggaccgtctgattgaccag
aagctaaaggattacgaggacctcagggaagacatgagaggaaaggaacatgaagtgaag
aaccttctagagaaggggaaagctgaacagcagaccgccgaccaactcctagctcgagcc
gatgctgccaaggcccttgctgaagaagctgctaagaagggacgcagtaccttacaagaa
gccaatgacattctcaacaacctgaaagattttgatagacgcgtgaacgataacaagaca
gccgcggaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcccagctagcgctgggcaatgctgccgctgacgccacggaggcc
aagaacaaggcccatgaggcagagaggattgccagcgccgtgcagaagaatgccaccagt
accaaggcggacgcagaaagaaccttcggggaagttacagatctggataatgaggtgaat
ggtatgctgaggcagctggaggaggcagagaatgagctgaagaagaagcaagatgatgcc
gaccaggacatgatgatggcagggatggcttcgcaggctgctcaggaggctgagctcaat
gccagaaaggccaaaaactctgtcagcagcctcctcagccagctgaacaacctcttggat
cagctaggacagctggacacagtggacctgaacaagctcaatgagatcgaaggctccctg
aacaaagccaaagacgaaatgaaggccagcgacctggacaggaaggtgtctgacctggag
agcgaggctcggaagcaggaggcagccatcatggactataaccgggacatagcagagatc
attaaggatattcacaacctggaggacatcaagaagaccctaccaaccggctgcttcaac
accccgtccatcgagaagccctag

KEGG   Mus musculus (mouse): 23928Help
Entry
23928             CDS       T01002                                 

Gene name
Lamc3, 1110064A23Rik, AI562206, AW240805
Definition
(RefSeq) laminin gamma 3
  KO
K06247  laminin, gamma 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    23928 (Lamc3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    23928 (Lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    23928 (Lamc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23928 (Lamc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    23928 (Lamc3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23928 (Lamc3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    23928 (Lamc3)
   05145 Toxoplasmosis
    23928 (Lamc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 23928
NCBI-ProteinID: NP_035966
MGI: 1344394
Ensembl: ENSMUSG00000026840
Vega: OTTMUSG00000012245
UniProt: Q9R0B6
LinkDB All DBs
Position
2; 2 B
AA seq 1581 aa AA seqDB search
MAVSRVLSLLATVASMALVIQETHFAAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEAS
HTCGRPPEDFCPHVGAPGAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTY
GRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDILISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACR
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDNSGVCPCKPTVTGWK
CDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQP
HNPVGCSSCFCYGHSKVCSPAAGFQEHHIRSDFRHGAGGWQIRSMGVSKRPLQWSQSGLL
LGLRGGEELSAPKKFLGDQRLSYGQPVILTLQVPPGGSPPPIQLRLEGAGLALSLRPSSL
PSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVL
LCEVQLTSAWPQRELAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYANCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPE
SGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHS
GHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVC
LPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTG
CQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPWGPLDILQGEAPLGDVYQGHHLL
QETRGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEEEV
LRAASALSFLASLQKGSSTPTNWSHLASEAQILARSHRDTATKIEATSERALLASNASYE
LLKLMEGRVASEAQQELEDRYQEVQAAQTALGIAVAEALPKAEKALATVKQVIGDAAPHL
GLLVTPEAMNFQARGLSWKVKALEQKLEQKEPEVGQSVGALQVEAGRALEKMEPFMQLRN
KTTAAFTRASSAVQAAKVTVIGAETLLADLEGMKLRSPLPKEQAALKKKAGSIRTRLLED
TKRKTKQAERMLGNAASLSSSTKKKSKEAELMSKDNAKLSRALLREGKQGYRHASRLASQ
TQATLRRASRLLLTSEAHKQELEEAKQVTSGLSTVERQIRESRISLEKDTKVLSELLVKL
GSLGVHQAPAQTLNETQRALESLRLQLDSHGALHHKLRQLEEESARQELQIQSFEDDLAE
IRADKHNLETILSSLPENCAS
NT seq 4746 nt NT seq  +upstreamnt  +downstreamnt
atggctgtatccagggtcctgtccctcctggcaacggtggcatcgatggcgctggtgatt
caggagacacacttcgcggcaggcgcggacatgggctcttgctacgacggtgtgggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgccgaggcctcc
cacacgtgcggacggcccccggaggacttctgtccacacgtgggggcaccaggggctggg
ctacagtgccagcgctgcgacgatgctgaccccggacgacgccacgacgcctcctacctc
acagacttccacagccccgatgacagcacctggtggcagagcccatccatggccttcggg
gtgcagtaccccacctctgttaacctgaccttgagcttagggaaggcctatgagattacc
tatgtgaggctgaagttccacaccagtcgccctgagagttttgccatctacaagcgcacg
tacgccagtggcccctgggagccctaccaatactacagtgcctcctgccagaaaacctat
ggccgtcctgagggccactacctgcgaccgggcgaggatgagagggtggccttctgcacc
tctgagttcagtgacatctcccccttgaacgggggcaacgtggccttctccaccctggaa
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggtcaccagc
actgacatcctgatctctctagatcggctcaacacgtttggggatgacatcttcaaggac
cccagagtgctccagtcttactactacgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggtcacgccagtgaatgcgaacccaatgcggctggtcagctggcttgccgc
tgtcagcacaacaccacaggagtggactgcgagcgttgtctgcccttcttccaggaccgt
ccgtgggcccgaggcaccgccgaggatgccaacgagtgtctgccctgcaactgcagtggg
cactctgaggagtgcacgtttgacagggagctctatcggagcacaggccatggtgggcac
tgtcagcggtgccgtgaccacacaactgggccacactgtgagcgctgtgagaagaactac
tacagatggtccccgaagacaccatgccaaccctgtgactgccacccagcaggctctctg
agtctccagtgtgacaactcaggcgtctgtccctgcaagcccacagtgacaggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtgcc
tgcaatgtcgccggcagcttgggcacctgtgacccccgcagtgggaactgtccctgcaaa
gagaatgtagaaggcagcctgtgtgacagatgccgccctgggacatttaacctgcagccc
cacaatccagtgggctgcagcagctgcttctgttatggccactccaaggtgtgttctcct
gctgccgggttccaggaacaccacatccgctcagacttccgccatggagctggtggctgg
cagatcagaagcatgggagtgtccaagcgtcctctgcaatggagccagagtgggctcctc
ctgggcctgcgaggaggggaggaactctcagccccaaagaagttcctgggagaccagaga
ctcagctatggacagccagtcatactgaccctccaagtaccccctggaggctccccacct
cctattcagctgagactggagggagcaggcttggctctgtctctgaggccctccagtcta
cccagccctcaggacaccaggcagccaagacgagttcagctccagttcctcttgcaggag
acttctgaggaggcagagtccccactgcccaccttccacttccagcgcctgctttccaat
ctgactgctctgagcatctggaccagtggccaaggaccgggccattctggccaagtgctc
ttgtgtgaagttcagctcacatcggcctggccccagcgtgagcttgcccctccagcctct
tgggtggagacctgcttatgtccccagggatacacaggccagttctgtgaattctgtgct
ctgggatacaagagagaaatacctcatgggggtccctatgccaactgcattccctgcacc
tgcaaccagcatggcacctgtgaccccaacacagggatctgcctgtgtggccaccacacc
gagggtccatcctgtgagcggtgcatgccaggtttctacggtaacgccttctcaggccgt
gctgatgattgccagccctgtccgtgccctggccaatcagcctgtgcaaccatcccagag
agtggagatgtggtgtgcacacactgccctcctggtcagagaggacgacgatgcgagagc
tgcgaagatggcttttttggggatcctctagggctctctggagctccccagccctgccgc
cgatgccagtgcagcgggaacgtggatctcaatgctgtgggcaactgtgatcctcattct
ggccactgcttgcgctgtctgtacaacacgacaggggcccactgcgagcactgtcgggag
ggtttctacgggagtgccgtggccacaaggcccgtggacaaatgtgctccctgcagctgt
gacctgaggggctcagtcagtgagaagacctgcaaccctgtgactggccagtgtgtctgc
ctgccttatgtctccgggagggactgcagccgctgcagccctggcttctatgacctccag
tctgggaggggctgccagagctgcaaatgtcacccacttggatccttggagaataagtgc
caccccaagactggccagtgtccctgccgacctggtgtcactggccaagcctgtgacaga
tgccagctaggtttctttggcttctccatcaagggctgccgagactgtaggtgctcccca
ttgggtgctgcctcatctcagtgccatgagaacagcacctgtgtgtgccggcccggcttt
gtgggctataaatgcgaccgctgccaggacaatttcttcctcgcggatggcgacacaggc
tgccaagagtgtcccacttgctatgccctagtgaaggaagaggcagccaagctgaaggcc
aggttgatgctgatggaggggtggcttcaaaggtctgactgtggtagcccctggggacca
ctagacattctgcagggagaagcccctctgggggatgtctaccaaggtcaccacctactt
caagagacccgggggaccttcctgcagcagatggtgggcctggaggattctgtgaaggcc
acttgggagcagttgcaggtgctgagagggcatgtacactgtgcccaggctggagctcag
aagacctgcatccagctggcagagctggaggagacattgcagtcctcagaggaggaggtc
cttcgtgcagcctcagctctctcatttctggcaagtcttcagaaaggatccagcacaccc
accaattggagtcacctggcatcagaggcccagatccttgccagaagccacagggacacg
gccaccaagatcgaagctacctcggaaagggccctgctcgcctccaacgccagctatgag
ctcctgaagctgatggaaggcagagtggcctcggaagcccagcaggaactggaggacagg
taccaggaggtgcaggcagctcagactgccctgggcatagctgtggcagaggcgctgccc
aaagctgaaaaggcactggccacggtgaagcaagtcattggtgacgcagccccacatcta
ggcttgctggtcacccctgaagcaatgaacttccaagccaggggcctgagctggaaagtg
aaggccctggagcagaagctggagcagaaggagcccgaggtgggccagtctgtgggagcc
ctgcaggtggaggctggaagagccttggagaagatggagccctttatgcagctacgcaat
aagaccacagctgccttcacacgggcttcctcagctgtgcaagctgccaaggtgaccgtc
ataggagcagagaccctgctagctgacctagagggaatgaagctgaggtctcctctaccc
aaggagcaggcagcgctgaagaagaaagcaggcagcatcaggaccaggctcctggaggac
acaaagaggaagaccaagcaggcagagaggatgctgggaaatgctgcctctctctcctcc
agcaccaagaagaaaagcaaagaagcagaactgatgtctaaggacaatgccaagctctcc
agagctttgctgagggaaggcaagcagggctaccgtcatgccagccgactcgccagccag
acccaggccacactccgtcgggcctctcgcctgctgctgacctcagaagcacacaagcag
gagctggaggaagctaaacaggtgacctctgggctgagcactgtggagcgccagatccga
gagtctcggatctccttggagaaggacaccaaggtcctgtcagagctgcttgtgaagctg
gggtccctgggtgtccaccaagcccctgctcagaccctgaacgagacccagcgggcacta
gaaagcttgaggctgcagctggattcccacggagccctgcatcacaaactgaggcagctg
gaggaagagtctgctcgacaggagctgcagattcagagctttgaggacgaccttgctgag
atccgcgctgacaagcacaacttggagaccattctgagcagtctgccagagaactgtgcc
agctag

KEGG   Mus musculus (mouse): 94216Help
Entry
94216             CDS       T01002                                 

Gene name
Col4a6, BB116301
Definition
(RefSeq) collagen, type IV, alpha 6
  KO
K06237  collagen, type IV, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    94216 (Col4a6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    94216 (Col4a6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    94216 (Col4a6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    94216 (Col4a6)
  09154 Digestive system
   04974 Protein digestion and absorption
    94216 (Col4a6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    94216 (Col4a6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    94216 (Col4a6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    94216 (Col4a6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    94216 (Col4a6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    94216 (Col4a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    94216 (Col4a6)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    94216 (Col4a6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   94216 (Col4a6)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   94216 (Col4a6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 94216
NCBI-ProteinID: NP_444415
MGI: 2152695
Ensembl: ENSMUSG00000031273
Vega: OTTMUSG00000018922
UniProt: B1AVK5 Q9ESQ1
LinkDB All DBs
Position
X; X F1-F2
AA seq 1691 aa AA seqDB search
MHPGLWLFLVSLCLTKELAESGQKMSYGKPCGSRDCHGVCTCFPEKGARGHPGPIGTQGP
AGPEGFTGPTGLSGLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGP
PGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLD
GIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRG
PMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGD
PGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEA
GLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSG
FCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTG
LKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFPGE
RGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIP
GSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEK
GLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSG
LPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISG
HPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKG
SSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRP
PMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSP
GSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGS
PGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGD
PGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPA
GLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGD
PGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGE
LGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPG
PLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQG
PPGFEGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLFVEG
QEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVGQTQ
IPQYISRCSVCEAPSQAIAVHSQDIIVPQCPLGWHSLWIGYSFLMHTAAGAEGGGQSLVS
PGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTGQLHTR
VSRCQVCMKTP
NT seq 5076 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctggattgtggctgttcctggtttccttatgcttgaccaaagaactggcagaa
tcgggacagaagatgtcctatggaaagccatgtgggagccgagattgccatggagtctgt
acatgctttcctgagaaaggagcaagagggcaccctggaccaattggaactcaaggtcca
gccggtccggaagggtttactggtccaactggtttatcaggtttgaaaggagaaagaggc
tccccaggccctctgggaccatatggatcaaaaggagataagggtcccattggagttcct
ggctttgttggcatcagtggtattccgggccaccctggacagccaggtccaagaggtcca
cctggcccagatggctgtaatggaactcaaggagctgttggatttccaggccctgatggc
taccctgggattttaggaccacctgggctgcctggtcacaaaggtgccaaaggagagcct
gttccttttcaaggcagcattacaggaataaggggagatcctgggctgcctggactagat
ggaatccctggtccatcaggatcctccggctctcctggagatgcaggacccataggacca
ccaggcttacaaggtcccccaggcctccccggacttcccggtcctgagggaaatatgggg
ttaggtttccaaggagaaaaaggagtcaagggggatgttggcctccctggccctgcagga
ccacctccatctactggggaactagaattcatgggattccccaaaggaaagaaaggttcc
aagggtgagccagggcctccaggtttcccaggaatgagtggccctccaggtgtcccggaa
tttggatctactggagaaaaaggagaaaaggggattcttggtttgccaggacctaggggt
cccatgggttcagaaggaatacaaggccatccagggagacagggaaagaaggggacttca
ggttttcctgggattaacgggttcccaggaattaagggtgaaaagggagacattggtgtt
cgaggcccagacagtttcactgatgcagatggcgctgtgatctcaggttatcctggagac
cctggtgtgctgggccttccaggccttagaggagatgaaggcgtccaaggccaacgtggc
ccttctggaacccctggcctcccatcattaacaggtcttccaggtgccctagggcctcag
ggatttcctggcctgaaaggagaccaaggaaactcaggacgtaccacctttggagaagct
ggcctacctggcagggttggtttaccaggtttaccaggcctgccaggcccatcaggccca
cctggtcgcacatttgagactggacatctgtccaacatagagcctgggttccctggtctc
caaggagaacaaggtccaaaaggacatcaaggcctcaaaggagtaaaaggagactctggt
ttttgtgcttgtgaaggtggtgcccccaacattggaccacatggggaaccaggtctgcct
gggatacaaggtcccattggtctacagggttttaaggggactaaaggagatccaggctca
aggggagcatctggtcctgcagggacgccagggctatttggacctagaggtcagactggc
ctcaaaggaaagaaaggagaaccaactgtcagtagaggatcaaaaatgtcaggggacaaa
ggtgaccctggtcctcagggtaccccaggtttggcaggaactccgggcaaggatggaaga
ccaggtttaccaggcctcccaggcattcagggagatggtgggtctggcttcccaggtgaa
agagggttaccaggacttcctggtgaaaaaggccatgatggtccaattggaccaccagga
attgggctgccaggacctcctgggccccgtggacttcctggagataaaggagtagatggg
ttaccagggcaacaaggcctccgtggagctcaaggagtcaccttgccttgtatcattcct
gggtcatatggtccatcaggatttcctggagctcctggattcccaggctctaagggagct
cggggcctccctggaattccaggcaagcctggcactcacggaagcaaaggagggcctggg
agtccagggttaatgcatctcccaggattgccagggtttcctggagttcgtggggagaag
ggattacctgggtttcctgggcttcctggaaaagatggctaccctgggaaagctggcagt
ccagggttaccaggtttcaagggagctgctggtgacatatttggtgctgaaaatggtgct
tcgggggagcaaggcctacagggattgccaggggacaaaggatttcctggagactctggc
cttccaggacccaagggtttgaatgggaaacctggtatgctaggccccaagggtgagcgg
ggcaaccctggaacatcaggaccaccaggacagccaggaccctcagggtctactgaccca
tttggcatcaagggcacatctggattcccaggagcaccaggccttccaggcatctcaggg
caccctggaaagaaaggtcaaagaggagacataggtcagcctggatcaactggaaaaaga
ggtctacctgggataaaaggccttcctggtcctcaagggtcacctggcttcctggggagc
ccaggtttgtcaggcgtcactgggttgccgggcatcgaaggccaaaagggtgaaaagggg
tcctctggaccagtaggatttcctgggttacctggtcttcctggtcttcctggagctgat
ggattaaagggattttctgggtcatttggaaaggtgggacaacctggacagactggtact
tccggagaaaaaggagacagaggggatccagggccagttggcatatctagtccaagacct
ccaatgctaaacctttggttcaaaggagaaaaaggctctcgaggttctgctggatcggat
ggatttcctgggcccagaggtgacaaaggagagcctggcatcccagggttaccaggtcca
cctggagctactggacaaaccaataccatcaaagggctcaatgggaggccaggttctcct
ggatctatgggaagaaggggattacctggcctgaaggggtctcttgggattgcaggtttc
ccaggaatgccagggaaaagcggttcacaggggctcactgggacttctggcctcctggga
gcaactggtatcccaggtttaaaaggagatcaaggccaaacacttggcatttctggaagc
ccaggacccaagggacagcctggagaattaggttttaaaggtgtcaaaggaaaagatgga
ctagttggtgatagaggttacccaggaaacaaaggtgatggtggaaaagttggaattact
ggagatcctggcttccctggctccccaggacttcaagggatttcaggtatgaatggagac
ccaggcctcccaggttcctctggccatctggggtcaattggccgccctggaccctcaggc
ttaataggacctaaaggattccctggagctcctggtttacatggactgaatggacttcca
ggcaccaagggcacccatggcactccaggagccagtatcactggtgttcctgggccggct
ggcctgcctggtcccaaaggggaaaggggagtgccaggaattgtcatcggagatccaggg
aaacaaggttcaaagggacaaaaaggtgaccaaggttccccaggtcttcaaggtcctgct
ggtacccctggagccccaggcatctccttgccctcagtcatagcaggacagcctggtgac
cctgggcggccaggcctagatggagaacgaggccgcccaggccctccaggtcctccaggt
ccccctgggccatcctcagatcaaggcgatcctggagactctggcttccctgggattcca
ggccttcaagggttcaagggaaaccaaggacttccaggtttctctggcctctctggagag
ctagggctaaagggcatgagaggggaacctggcctcatggggactcctggcaagatcggg
caaccaggagacccaggatttcctgggatgaaggggaaggcggggccaagaggcttttcc
ggcccacagggagctccaggacacacaccaattgctgaagctatgcaggttcctccagga
cctttgggtctgccaggcattgatggtatcccaggcctcataggagaccctgggtctcaa
ggctctgtgggtctgcaaggttccaaaggcctacctggcatccctggtaaggatggcccc
agtgggcttccaggcccatctggaatccttggtgatcctggtctccctggactacaagga
cctccaggatttgaaggagctccgggaaatcagggccccattgggcagcctgggatgcct
gggcacggtgtgagagtgggctacacactagtaaaacacagtcagtcagaacaggtgcca
ctatgccccactgggatgagccggctctgggtgggttacagcttgctcttcgtggagggg
caggagaaagcccataaccaggatctgggatttgctggctcctgcctgccccgattcagc
accatgcccttcatatactgcaacatcaatgaagtgtgccactatgccagacgcaatgat
aaatcttactggctctccactactgcccccattcccatgatgcctgtgggccagacccag
attccccagtatatcagccgctgctctgtatgtgaggcaccctcacaagccattgctgta
cacagtcaggacatcattgtcccacagtgccctctgggctggcacagcctctggatcgga
tactccttcctcatgcacactgctgctggggctgagggtggaggccagtccctagtctcc
cctggctcgtgtcttgaggacttccgggccactcctttcattgagtgcagcggcgcccgt
ggtacatgccactactttgccaacaagtacagtttctggctgacaacggtggaggagaga
gggcagtttcgggaagagcccgtgtctgagacgctgaaaactgggcagcttcacaccagg
gtgagccgctgccaggtgtgtatgaaaaccccgtag

DBGET integrated database retrieval system