KEGG   Mus musculus (mouse): 12915
Entry
12915             CDS       T01002                                 

Gene name
Atf6b, AA617266, ATF6be, ATF6beta, Creb, Creb-rp, Crebl1
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12915 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12915 (Atf6b)
   04022 cGMP-PKG signaling pathway
    12915 (Atf6b)
   04151 PI3K-Akt signaling pathway
    12915 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12915 (Atf6b)
   04915 Estrogen signaling pathway
    12915 (Atf6b)
   04926 Relaxin signaling pathway
    12915 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    12915 (Atf6b)
   04918 Thyroid hormone synthesis
    12915 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    12915 (Atf6b)
   04925 Aldosterone synthesis and secretion
    12915 (Atf6b)
   04927 Cortisol synthesis and secretion
    12915 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12915 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    12915 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    12915 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12915 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    12915 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    12915 (Atf6b)
   05031 Amphetamine addiction
    12915 (Atf6b)
   05034 Alcoholism
    12915 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12915 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12915 (Atf6b)
   05161 Hepatitis B
    12915 (Atf6b)
   05163 Human cytomegalovirus infection
    12915 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12915 (Atf6b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    12915 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB Docking
Other DBs
NCBI-GeneID: 12915
NCBI-ProteinID: NP_059102
MGI: 105121
Ensembl: ENSMUSG00000015461
Vega: OTTMUSG00000037081
UniProt: Q3UJ07 A0A0A0MQ69
LinkDB
Position
17 B1; 17 18.22 cM
AA seq 706 aa
MVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQAQLFRCVEQDV
PFDSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPPSQVP
GVGEVLHVKMESLAPPLCLLGDDPASPFETVQITVGSASDDLSDIQTKLEPASPSSSVHS
EASLLSADSPSQPFIGEEVLEVKTESPSPPGCLLWDVPASSLGAVQISMGPSPDSSSGKA
PATRKPPLQPKPVVLTTVPVPPRAGPTSAAVLLQPLVQQPAVSPVVLIQGAIRVQPEGPA
PAAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEAR
LQAVLADNQQLRRENAALRRRLEALLAENSGLKLGSGNRKVVCIMVFLLFIAFNFGPVSI
SEPPPAPMSPRMSREEPRPQRHLLGFSEPGPAHGMEPLREAAQSPGEQQPSSAGRPSFRN
LTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPHRAQE
RQKSQLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPGRSQPEFLDAIDRREDTFYVVS
FRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTRVIH
IKTSTVPPSLRKQPSPSPGNTTGGPLPGSAASPAHQASQPLYLNHP
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggtggggggtggggggaagatggcggagctgatgctcctcagtgagatcgccgacccg
acgcgcttcttcaccgacaacctgctgagtccggaggactgggacagcaccttgtacagt
ggcctggatgaagtggccgaggagcaggcacagttgttccgttgcgtggagcaggatgtc
ccgtttgacagcagctctctggatgtggggatggatgtcagcccccctgagcccccttgg
gaccctctacccatcttcccagatcttcaggtgaagtccgagccatcctctccctgctcg
tcctcctccctcagctcagagtcctcacatctttccacagagccccccagccaggtccct
ggtgtaggcgaggtgctgcatgtgaagatggagtccctggcacccccactctgcctgctg
ggggatgatccagcatccccctttgaaacggtccagatcactgtgggctctgcctctgat
gatctttcagatatccagaccaagctggaacctgcctctccgtcttcttctgtccactct
gaggcctccttgctgtcagcagactctcccagtcagccttttataggagaggaggttctg
gaagtgaagacagagtctccgtcccctccagggtgcctcctgtgggatgtcccagcctct
tcgctcggagctgtccagatcagcatgggtccatcccctgatagttcctcagggaaagct
ccggccactcggaagcctccactgcagcccaagcctgtggtactaaccacagttccggtg
ccacctagagctgggcctaccagcgctgccgtcctcctgcaacccctggtccagcagcct
gcggtgtccccagtggtcctcatccaaggtgctatccgagtccagcctgaagggccagct
cccgcagctccccggcctgagaggaagagcattgttccagcccctatgccggggaactcc
tgcccgcctgaagtggatgcaaagctgttgaagcggcagcagcggatgatcaagaatcga
gagtcggcctgccagtcccgccgcaagaagaaagagtacctgcaaggcctggaggcccgg
ctgcaggctgtgctggccgacaaccagcagctgcgcagggagaacgctgccctccggcgg
cggctggaggccctgctggcagagaacagcgggctcaagctggggtctggaaacaggaag
gttgtctgcatcatggtcttccttctcttcattgccttcaactttgggcctgtgagcatc
agcgagccgcctccagctcccatgtctcctcggatgagcagggaggaacctcgaccccag
aggcacctgctgggcttctcagaaccagggccagctcatggcatggaaccccttcgggaa
gccgcccagagccccggggagcagcagcccagctctgcaggcaggcccagcttcagaaac
ctgacggccttccccgggggagccaaggagctgctgctgagagacctggaccagctcttc
ctctcctcagactgtcgccatttcaaccgaactgagtctctgaggcttgctgatgagctg
agtggctgggtccaacgtcaccagagaggtcgacggaagatacctcacagggcccaggag
agacagaagtctcagctacggaagaagtctcctccagtgaaacctgtccccacccaacct
ccaggaccccctgaaagggaccccgtgggccagctgcagctctaccgccaccccggccgc
tcgcagccggagtttctagacgcaattgaccggagggaggataccttctatgttgtctcc
ttccgaagggaccacctgctgctcccagccatcagccacaacaagacatccaggcccaag
atgtcgctggtgatgccagccatggcccccaatgagaccgtgtcaggccggggcccccca
ggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcac
atcaagacctctacggtgcccccctcgctccggaagcagccgtccccatccccgggcaat
accacaggtggccccttgccaggctccgcagctagtcctgcccatcaggcctcccagccc
ctctacctcaatcacccctga

DBGET integrated database retrieval system