KEGG   Mus musculus (mouse): 12927Help
Entry
12927             CDS       T01002                                 

Gene name
Bcar1, AI385681, Cas, Crkas
Definition
(RefSeq) breast cancer anti-estrogen resistance 1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    12927 (Bcar1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12927 (Bcar1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12927 (Bcar1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12927 (Bcar1)
   04062 Chemokine signaling pathway
    12927 (Bcar1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    12927 (Bcar1)
   05100 Bacterial invasion of epithelial cells
    12927 (Bcar1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    12927 (Bcar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 12927
NCBI-ProteinID: NP_001185768
MGI: 108091
Ensembl: ENSMUSG00000031955
Vega: OTTMUSG00000061802
UniProt: Q61140 Q3TJP4
LinkDB All DBs
Structure
PDB: 

Position
8; 8 E1
AA seq 874 aa AA seqDB search
MKYLNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPVGPGPGPPATPPQPQPSLPQGVHAPVPPASQYSPMLPTAYQPQSDNVYL
VPTPSKTQQGLYQAPGPNPQFQSPPAKQTSTFSKQTPHHSFPSPATDLYQVPPGPGSPAQ
DIYQVPPSAGIGHDIYQVPPSLDTRGWEGTKPPAKVVVPTRVGQGYVYEAAQTEQDEYDT
PRHLLAPGPQDIYDVPPVRGLLPNQYGQEVYDTPPMAVKGPNGRDPLLDVYDVPPSVEKG
LLSSSHHSVYDVPPSVSKDVPDGPLLREETYDVPPAFAKPKPFDPTRHPLILAAPPPDSP
AAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGSVVDDGVYAVPPPA
EREAPTDGKRLSASSTGSTRSSQSASSLEVVVPGREPLELEVAVESLARLQQGVSTTVAH
LLDLVGSASGPGGWRGTSEPQEPPAQDLKAAVAAVHGAVHELLEFARGAVSNATHTSDRT
LHAKLSRQLQKMEDVYQTLVVHGQVLDSGRGSPGFTPEDLDRLVACSRAVPEDAKQLASF
LHGNASLLFRRTKAPGPGPEGSSSLHPNPTDKASSIQSRPLPSPPKFTSQDSPDGQYENS
EGGWMEDYDYVHLQGKEEFEKTQKELLERGNIMRQGKGQLELQQLKQFERLEQEVSRPID
HDLANWTPAQPLVPGRTGGLGPSDRQLLLFYLEQCEANLTTLTDAVDAFFTAVATNQPPK
IFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQ
YPSPSAAQDMVDRVKELGHSTQQFRRVLGQLAAA
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctgaacgtgctggccaaagccctctatgacaatgttgctgaatccccggat
gagctctccttccgaaagggtgacatcatgacagtgctcgagcgggacactcagggcctg
gatggctggtggctctgctcactgcatgggcgccagggcattgtgcctggtaaccgcctc
aagattctggttggcatgtatgataagaagccagtaggacctggaccaggcccacctgcc
accccaccccagccccagcccagccttccccagggcgtccatgctccggtacctccagct
tcccagtacagtcccatgctccccactgcgtaccagccccagtctgacaatgtgtacctg
gtacccactcccagcaagactcagcaaggtctctaccaagcccctgggcccaacccacag
ttccagtcacccccagccaaacagacgtccacattctccaagcaaacacctcatcactca
tttcccagcccagccacggacctttaccaggtgcccccagggcctggaagtccagcccag
gacatttatcaggtgccaccttccgctggcatagggcatgacatctaccaagttcctcca
tctctggacactcgcggatgggagggaacaaagccaccggcaaaggtggtggttcctacg
cgagtgggacagggctatgtgtatgaggccgctcagacggagcaggatgagtacgacacc
ccacgccacctgctggccccaggtccccaggacatctatgatgtgccccctgttcgagga
ctgcttcctaaccagtatggccaggaggtatatgacacgccccctatggcagtcaaaggc
cccaatggccgagacccattgttggatgtgtatgacgtgccccctagtgtggagaaaggc
ctgctctcgtccagccatcattcggtgtatgatgttcctccttctgtgagcaaggatgtg
cccgatggcccactgctgcgtgaggaaacctatgatgtacctcctgccttcgccaagccc
aagccctttgatcccacccgacacccactgatccttgctgcgcctcctcccgactcccca
gcagctgaggatgtatatgatgtgcccccccctgctcccgacctctatgatgtgccccct
ggtttgcggcggcctggccctggaacactgtatgacgtgcctcgcgagcgcgtgctccct
cctgaggtggctgatgggagtgtagttgacgatggtgtgtatgctgtgcccccaccagcc
gagcgagaggccccaacggatggcaagcgcctgtcggcctctagcacgggcagcacgcgc
agcagccaatcggcatcttccttggaggtggtggtgccaggccgggagcccctggaactg
gaggttgctgtggagtccctggctcggctgcagcaaggcgtgagcaccaccgtagcccac
cttctggacctggtgggcagtgccagtgggcctgggggctggcgtggtacctctgagcct
caggagcctcccgcacaggacctgaaagccgcagtggcggcagttcacggggcagtccat
gagctcctggagttcgcccgcggagctgtgagcaatgccacccacacttctgaccgcacc
ttgcatgccaagcttagccggcaactacagaagatggaggatgtgtaccagacactggtg
gtccacggtcaggtccttgacagtggccgaggaagtccaggattcactccggaagacctg
gaccgcctggtggcctgctctcgggctgtgcccgaggatgccaagcagctagcttccttt
ttgcatggcaatgcctcgctgcttttcagacggaccaaagcccctggcccagggcctgag
ggaagcagctccctgcacccaaaccccactgataaagccagtagcatccagtcacgccct
ctcccctcacctccaaagttcacctcccaggactctccagacggccagtatgagaacagt
gaagggggttggatggaggactatgactacgtccatctgcaggggaaggaggaatttgag
aagacccagaaggagctgctagaaaggggtaacatcatgcggcagggaaagggccaactg
gagttgcagcagctgaaacagtttgagcgactggagcaggaggtgtctcgtccaatagac
cacgacctggccaactggacaccagcccagcccctggtgccgggccggacagggggcctg
gggccttcagaccgacagctgctgctcttctacttggagcagtgcgaggccaacctgacc
acactgacagatgcagtggacgccttcttcactgcggtggccaccaaccaaccacccaag
atctttgtggcacacagcaagtttgtcattctcagtgcccacaagcttgtgttcattggg
gacacactgtcacggcaggcaaaggcagctgatgtccgaagccaagtgacccactacagc
aatctgctgtgtgacctcctgcgtggcattgtggccaccaccaaggctgctgccctgcag
tacccatccccttccgctgcccaggacatggtggacagggtcaaggagctaggccacagc
actcagcagttccgccgcgtcctgggccagctagctgctgcctga

DBGET integrated database retrieval system