KEGG   Mus musculus (mouse): 12982Help
Entry
12982             CDS       T01002                                 

Gene name
Csf2ra, CD116, Csfgmra, GM-CSF-Ra, GM-CSFR
Definition
(RefSeq) colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    12982 (Csf2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12982 (Csf2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12982 (Csf2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12982 (Csf2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12982 (Csf2ra)
   04090 CD molecules [BR:mmu04090]
    12982 (Csf2ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   12982 (Csf2ra)
CD molecules [BR:mmu04090]
 Proteins
  12982 (Csf2ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind IL3Ra_N fn3
Motif
Other DBs
NCBI-GeneID: 12982
NCBI-ProteinID: NP_034100
MGI: 1339754
Ensembl: ENSMUSG00000059326
UniProt: Q00941
LinkDB All DBs
Position
19 D3; 19 56.89 cM
AA seq 388 aa AA seqDB search
MTSSHAMNITPLAQLALLFSTLLLPGTQALLAPTTPDAGSALNLTFDPWTRTLTWACDTA
AGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSF
VNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGD
DVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSH
CTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKV
RAGDTRMKHWGEWSPAHPLEAEDTRVPGALLYAVTACAVLLCALALGVTCRRFEVTRRLF
PPIPGIRDKVSDDVRVNPETLRKDLLQP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcacatgccatgaacatcacccccctggctcagctcgccctgctcttctcc
acgctactgcttccgggaactcaggcccttctggctccgaccacaccggacgccggctcc
gccctcaacctgaccttcgacccctggactcggacgctgacctgggcctgcgacaccgcc
gcggggaacgtcacggtgacgtcatgcaccgtgacctcgcgggaggcggggatacaccgg
cgagtctcgcccttcggttgccgctgctggttcaggaggatgatggcgctgcaccacggt
gtcacgctggatgtcaatggcacggtcgggggcgcggccgcgcactggaggctgagcttc
gtcaacgaaggcgcggcgggctcgggggcggagaacctgacctgcgagatccgagccgcg
cgcttcctttcctgcgcgtggcgggaggggccagcggcgcccgcggacgtccggtactcg
ctgcgagtcctcaactccacgggtcacgacgtggcgcgatgcatggccgaccccggggat
gacgtcatcacacagtgcattgcgaacgacttgtcactgctggggagtgaggcctacttg
gtcgtgaccggtcggagcggtgcggggccagtgcggttcctggacgacgtggtggctacg
aaggcgctcgagcgactcggtcccccacgtgacgtcaccgcgtcctgtaactcttcccac
tgcaccgtctcgtgggccccgccctcgacctgggcatccttgacggcccgggacttccag
tttgaggtccagtggcagagcgcagagccaggaagcacaccccggaaggtgctcgtcgtg
gaggagacccgcctcgccttccccagccccgccccccacggaggtcacaaggtcaaggtg
cgcgcgggcgacacgaggatgaagcactggggcgaatggagtcccgcccatcctctcgag
gctgaggacacgcgagtgcccggtgcgctcctgtatgcagtgacagcctgcgcagtccta
ctgtgcgcgctggcgctcggagtgacgtgcaggaggttcgaggtgacgcgccgactcttc
ccgcccatcccagggatcagggacaaggtgtccgacgacgtgcgagtgaaccctgagacc
ctcaggaaggacctcctgcagccctag

DBGET integrated database retrieval system