KEGG   Mus musculus (mouse): 12983Help
Entry
12983             CDS       T01002                                 

Gene name
Csf2rb, AI848964, AIC2B, Bc, CDw131, Csf2rb1, Csfgmrb, Il3r, Il3rb, Il3rb1, Il5rb
Definition
(RefSeq) colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage)
  KO
K04738  cytokine receptor common subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04210  Apoptosis
mmu04630  Jak-STAT signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    12983 (Csf2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12983 (Csf2rb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12983 (Csf2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12983 (Csf2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12983 (Csf2rb)
   04090 CD molecules [BR:mmu04090]
    12983 (Csf2rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   12983 (Csf2rb)
CD molecules [BR:mmu04090]
 Proteins
  12983 (Csf2rb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind Tissue_fac EpoR_lig-bind IL4Ra_N Interfer-bind fn3 Pur_ac_phosph_N IL2RB_N1 Comm
Motif
Other DBs
NCBI-GeneID: 12983
NCBI-ProteinID: NP_031806
MGI: 1339759
Ensembl: ENSMUSG00000071713
UniProt: P26955
LinkDB All DBs
Position
15 E1; 15 37.36 cM
AA seq 896 aa AA seqDB search
MDQQMALTWGLCYMALVALCWGHGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGL
INMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDS
DLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKR
LQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDS
QPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPP
GASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSL
HWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKP
ISNYDGIWSKWSEEYTWKTDWVMPTLWIVLILVFLILTLLLILRFGCVSVYRTYRKWKEK
IPNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGESYAHLEDNNVSPL
TIEDPNIIRVPPSGPDTTPAASSESTEQLPNVQVEGPTPNRPRKQLPSFDFNGPYLGPPQ
SHSLPDLPDQLGSPQVGGSLKPALPGSLEYMCLPPGGQAQLVPLSQVMGQGQAMDVQCGS
SLETSGSPSVEPKENPPVELSMEEQEARDNPVTLPISSGGPEGSMMASDYVTPGDPVLTL
PTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAAKSPP
GHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPS
PSLCSETEDLVQDLSVKKFPYQPMPQAPAIQFFKSLKHQDYLSLPPWDNSQSGKVC
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcaaatggcactcacatgggggctgtgctacatggcactggtggctctctgt
tggggacacggggtgacagaggcagaagaaacggtccctctgaagactctgcagtgctac
aatgactacaccaaccacatcatctgcagctgggcggacacagaggatgcccaggggcta
atcaacatgaccctctatcaccagctagagaaaaaacagccagtgtcctgtgagctcagt
gaggaactcatgtggtcagagtgcccgtcatcccaccgctgtgtgcccagaagatgtgtc
atcccctatacacgattttccatcacaaacgaagactactactccttccggccagatagt
gatctgggcatccagctcatggtgccacttgcccagaatgtgcagccaccacttcccaag
aacgtcagcatcagctcctctgaggatcgtttcctgctggagtggagtgtgtcccttggg
gatgcccaggtctcctggctttcatcaaaggacatagagtttgaggtggcttataagcgg
cttcaggactcctgggaggatgcctacagtctccacactagcaaatttcaggtgaatttc
gagccaaagctattcctacccaacagcatctatgctgcccgtgtgcgcactcggctgtcc
ccgggttcaagcttgtctgggagacccagcagatggagcccagaggttcactgggactcc
cagccaggggacaaggcccagccacagaaccttcaatgcttctttgatgggatccagtcc
ctccactgctcctgggaggtgtggacccagacgactggctctgtttcctttgggctcttc
tatcgccccagccctgtagctccggaggagaaatgctctccggtggtgaaggagccgccg
ggggccagtgtctacacccgctaccattgcagtctacctgtgcctgagcccagtgcacac
agccagtacacagtctctgttaagcacctggaacaagggaagttcatcatgagctataac
cacatccagatggagcctccaaccctcaacctgaccaagaacagagacagctacagcctg
cattgggaaactcagaagatggcttactcattcattgagcacacattccaggtccagtac
aagaagaaatcggacagctgggaggacagcaagacagagaacctagatcgagcccatagc
atggacctctcccagctggagccagacacctcatactgcgccagggtgagggtcaagccc
atctctaactacgatgggatctggagcaagtggagcgaagagtacacttggaagactgac
tgggtgatgcccacgctgtggatagtcctcatcctggtctttctcatcctcaccttgctc
ctgatccttcgctttggctgtgtctctgtatacaggacgtacaggaagtggaaggaaaag
atccccaaccccagcaagagcctcctgttccaggatggaggtaaaggtctctggcctcct
ggcagcatggcagccttcgccactaagaaccccgctctccaggggccacagagcaggctt
cttgctgagcaacagggggagtcatatgcacatttggaagacaacaacgtgtcacctctc
actatagaggaccctaatataattcgagttccaccatccgggcctgatacaaccccagct
gcctcatccgaatccacagagcaacttcccaatgttcaagtagagggaccaactcctaac
agacctaggaagcaattacccagctttgacttcaatgggccctacctggggcctccccaa
tcccactctctgcctgatctcccagaccagctgggttccccccaggtgggtgggagcctg
aagccagcactgccaggctccttggagtacatgtgtctgccccctggaggtcaagcgcaa
ctggttccattgtcccaggtgatggggcagggccaggctatggatgtgcagtgtgggtcc
agcctggagacctcagggagcccttctgtggagccaaaggagaaccctccagttgagctg
agcatggaggaacaggaggcacgggacaacccagtgactctgcccataagctctgggggc
cctgagggcagtatgatggcctctgattatgtcactcctggagatccggtgctcactctg
cccacagggcccctgtctacctctctgggcccctctctagggttgccctcagcccaaagc
cccagtctctgtcttaagctgcccagggtcccctctggaagcccagctctagggccacca
gggtttgaggactatgtggagctgcctccaagtgtgagccaggctgccaagtcccctcca
ggccatcctgctcctcctgtggcaagcagccccacagtgatcccaggagagcccagggag
gaagtgggcccagcatccccacatcccgaaggcctccttgttcttcagcaggttggggac
tactgcttcctccctggcctgggacctggctccctctcaccacacagtaagccaccctct
ccaagtctgtgttctgagactgaggacctagtccaggacttgtctgtcaaaaagtttccc
tatcagcccatgccccaggcgccagccattcagtttttcaagtccctaaagcatcaggac
tacctgtccctgcccccttgggacaatagccagtctgggaaggtgtgctga

KEGG   Mus musculus (mouse): 12984Help
Entry
12984             CDS       T01002                                 

Gene name
Csf2rb2, AIC2A, BetaIl3, Bil3, Csfgmrb, Il3r, Il3rb, Il3rb2
Definition
(RefSeq) colony stimulating factor 2 receptor, beta 2, low-affinity (granulocyte-macrophage)
  KO
K04738  cytokine receptor common subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04210  Apoptosis
mmu04630  Jak-STAT signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    12984 (Csf2rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12984 (Csf2rb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12984 (Csf2rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12984 (Csf2rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12984 (Csf2rb2)
   04090 CD molecules [BR:mmu04090]
    12984 (Csf2rb2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   12984 (Csf2rb2)
CD molecules [BR:mmu04090]
 Proteins
  12984 (Csf2rb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind EpoR_lig-bind IL4Ra_N fn3 Interfer-bind IL2RB_N1 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 12984
NCBI-ProteinID: NP_031807
MGI: 1339760
Ensembl: ENSMUSG00000071714
UniProt: P26954
LinkDB All DBs
Structure
PDB: 

Position
15 E1; 15 37.22 cM
AA seq 878 aa AA seqDB search
MDQQMALTWGLCYMALVALCWGHEVTEEEETVPLKTLECYNDYTNRIICSWADTEDAQGL
INMTLLYHQLDKIQSVSCELSEKLMWSECPSSHRCVPRRCVIPYTRFSNGDNDYYSFQPD
RDLGIQLMVPLAQHVQPPPPKDIHISPSGDHFLLEWSVSLGDSQVSWLSSKDIEFEVAYK
RLQDSWEDASSLHTSNFQVNLEPKLFLPNSIYAARVRTRLSAGSSLSGRPSRWSPEVHWD
SQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPAAPEEKCSPVVKEP
QASVYTRYRCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYYHIQMEPPILNQTKNRDSYSL
HWETQKIPKYIDHTFQVQYKKKSESWKDSKTENLGRVNSMDLPQLEPDTSYCARVRVKPI
SDYDGIWSEWSNEYTWTTDWVMPTLWIVLILVFLIFTLLLALHFGRVYGYRTYRKWKEKI
PNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGVSYEHLEDNNVSPLT
IEDPNIIRDPPSRPDTTPAASSESTEQLPNVQVEGPIPSSRPRKQLPSFDFNGPYLGPPQ
SHSLPDLPGQLGSPQVGGSLKPALPGSLEYMCLPPGGQVQLVPLSQVMGQGQAMDVQCGS
SLETTGSPSVEPKENPPVELSVEKQEARDNPMTLPISSGGPEGSMMASDYVTPGDPVLTL
PTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAATSPP
GHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPS
PSLCSETEDLDQDLSVKKFPYQPLPQAPAIQFFKSLKY
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcaaatggcactcacatgggggctgtgctacatggcactggtggctctctgc
tggggacacgaggtgacagaggaagaagaaacggtccctctgaagactctggagtgctac
aatgactacaccaaccgtatcatctgcagctgggcagacacagaggatgcccaggggcta
atcaacatgaccctcctctatcaccagctagacaagattcaatcagtgtcctgtgagctc
agtgagaaactcatgtggtcagagtgcccgtcatcccaccgctgtgtgcccagaagatgt
gtcatcccctacacacgattttctaatggagataacgactactactccttccagccagat
cgtgacctgggcatccagctcatggtcccactggcccagcatgtgcagccaccccctccc
aaggacatccacatcagcccctctggggatcatttcctgctggaatggagtgtatctctt
ggggattcccaggtctcctggctttcatcaaaggacatagagtttgaggtggcttataag
cggcttcaggactcctgggaggatgcctccagtctccacactagcaactttcaggtgaat
ttagagccaaagctattcctacccaacagcatctatgctgcccgtgtgcgcactcggctg
tccgcgggttcaagcttgtctgggagacccagcagatggagcccagaggttcactgggac
tcccagccaggggacaaggcccagccacagaaccttcaatgcttctttgatgggatccag
tctctccactgctcctgggaggtgtggacccagacgactggctctgtttcctttgggctc
ttctatcgccccagccctgcagctccggaggagaaatgctctccggtggtgaaggagccg
caggccagcgtctacacccgctaccgctgcagtctacctgtgcctgagcccagtgcacac
agccagtacacagtctctgttaagcacctggaacaagggaagttcatcatgagctattac
cacatccagatggaacctccaatcctcaaccagaccaagaacagagacagctacagcctg
cattgggaaactcagaaaatacccaaatacattgatcacactttccaggtccagtacaag
aagaagtcagagagctggaaggacagcaagacagaaaacctaggtcgagtcaatagcatg
gacctgccccagctggagccggacacctcatactgcgccagggtgagggtcaagcccatc
tctgactacgacgggatctggagcgagtggagcaatgagtacacttggacgactgactgg
gtgatgcccacgctgtggatagtcctcatcctggtctttctcatcttcaccttgctcctg
gctctccactttggccgtgtttatgggtacaggacatacaggaagtggaaggaaaagatc
cccaaccccagcaagagcctcctgttccaggatggaggtaaaggtctctggcctcctggc
agcatggcagccttcgcgactaagaaccccgctctccaggggccacagagcaggcttctt
gctgagcaacagggggtgtcatatgaacatttggaagacaacaacgtgtcacctctcact
atagaggaccctaatataattcgagatccaccatccaggcctgatacaaccccagctgcc
tcatctgaatccacagagcaacttcccaatgttcaagtagagggaccaattccttctagc
cgacccaggaagcaattacccagctttgacttcaatgggccctacctggggcctccccaa
tcccactccctgcctgatctcccaggccagctgggttctccccaggtgggtgggagcctg
aagccagcactgccaggctccttggagtacatgtgtctgccccctggaggtcaagtgcaa
ctggtcccattgtcccaggtgatgggacagggccaggctatggatgtgcagtgtgggtcc
agcctggagaccacagggagcccttccgtggagccaaaggagaaccctccagttgagctg
agcgtggagaaacaggaggcaagggacaacccaatgactcttcccataagctctgggggc
cctgagggcagtatgatggcctctgattatgtcactcctggagatccggtgctcactctg
cccacagggcccctgtctacctctctgggcccctctctagggttgccctcagcccaaagc
cccagtctctgtcttaagctgcccagggtcccctctggaagcccagctctagggccacca
gggtttgaggactatgtggagctgcctccaagtgtgagccaggcagccacgtcccctcca
ggccatcctgctcctcctgtggcaagcagccccacagtgatcccaggagagcccagggag
gaagtgggcccagcatccccacatcccgaaggcctccttgttcttcagcaggttggggac
tactgcttcctccctggcctgggacctggctccctctcaccacacagtaagccaccctct
ccaagtctgtgttctgagactgaggacctagaccaggacttgtctgtgaaaaagtttccc
tatcaacccttgccccaggccccagccattcagtttttcaagtccctaaagtattag

KEGG   Mus musculus (mouse): 13857Help
Entry
13857             CDS       T01002                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    13857 (Epor)
   04151 PI3K-Akt signaling pathway
    13857 (Epor)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13857 (Epor)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    13857 (Epor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13857 (Epor)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    13857 (Epor)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   13857 (Epor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind PCSK9_C1
Motif
Other DBs
NCBI-GeneID: 13857
NCBI-ProteinID: NP_034279
MGI: 95408
Ensembl: ENSMUSG00000006235
Vega: OTTMUSG00000062323
UniProt: P14753 Q3UTV9
LinkDB All DBs
Structure
PDB: 

Position
9 A3; 9 7.93 cM
AA seq 507 aa AA seqDB search
MDKLRVPLWPRVGPLCLLLAGAAWAPSPSLPDPKFESKAALLASRGSEELLCFTQRLEDL
VCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLE
LQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYE
VDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPAS
LLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPGIPSPESEFEGLFTTHK
GNFQLWLLQRDGCLWWSPGSSFPEDPPAHLEVLSEPRWAVTQAGDPGADDEGPLLEPVGS
EHAQDTYLVLDKWLLPRTPCSENLSGPGGSVDPVTMDEASETSSCPSDLASKPRPEGTSP
SSFEYTILDPSSQLLCPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQGVHGDSS
DGPYSHPYENSLVPDSEPLHPGYVACS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcagggtgcccctctggcctcgggtaggccccctctgtctcctacttgct
ggggcagcctgggcaccttcacccagcctcccggaccccaagtttgagagcaaagcggcc
ctgctggcatcccggggctccgaagaacttctgtgcttcacccaacgcttggaagacttg
gtgtgtttctgggaggaagcggcgagctccgggatggacttcaactacagcttctcatac
cagctcgagggtgagtcacgaaagtcatgtagcctgcaccaggctcccaccgtccgcggc
tccgtgcgtttctggtgttcactgccaacagcggacacatcgagttttgtgccgctggag
ctgcaggtgacggaggcgtccggttctcctcgctatcaccgcatcatccatatcaatgaa
gtagtgctcctggacgcccccgcggggctgctggcgcgccgggcagaagagggcagccac
gtggtgctgcgctggctgccacctcctggagcacctatgaccacccacatccgatatgaa
gtggacgtgtcggcaggcaaccgggcaggagggacacaaagggtggaggtcctggaaggc
cgcactgagtgtgttctgagcaacctgcggggcgggacgcgctacaccttcgctgttcga
gcgcgcatggccgagccgagcttcagcggattctggagtgcctggtctgagcccgcgtca
ctactgaccgctagcgacctggaccctctcatcttgacgctgtctctcattctggtcctc
atctcgctgttgctgacggttctggccctgctgtcccaccgccggactctgcagcagaag
atctggcctggcatcccaagcccagagagcgagtttgagggtctcttcaccacccacaag
ggtaacttccagctgtggctgctgcagcgtgatggttgtctgtggtggagcccgggcagc
tccttccctgaggatccacctgcccacctagaggtcctctcagagccacgctgggcagtg
actcaggctggggacccaggggcagatgatgaggggcccttactggagccggtgggcagt
gagcatgcccaggacacctacttggtattggataagtggttgctgccccggaccccatgc
agtgagaacctctcagggcctgggggcagtgtggaccctgtgactatggatgaagcttca
gaaacatcttcctgcccgtctgacttggcctcaaagcccaggccagagggcacctcacct
tccagctttgagtacaccatcctggaccccagctctcagctcctgtgccctcgggcactg
cctcccgagctacctcccactccacctcacttgaagtacctataccttgtggtgtccgat
tctggcatctcaacagattacagttcggggggctctcagggagtccacggggactcatct
gatggcccctactcccacccctatgagaacagccttgtcccagactcagagcctctgcat
cccggctatgtggcctgctcctag

KEGG   Mus musculus (mouse): 15975Help
Entry
15975             CDS       T01002                                 

Gene name
Ifnar1, Ifar, Ifnar, Ifrc, Infar
Definition
(RefSeq) interferon (alpha and beta) receptor 1
  KO
K05130  interferon receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    15975 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    15975 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15975 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15975 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15975 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    15975 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    15975 (Ifnar1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15975 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15975 (Ifnar1)
  09172 Infectious disease: viral
   05162 Measles
    15975 (Ifnar1)
   05164 Influenza A
    15975 (Ifnar1)
   05161 Hepatitis B
    15975 (Ifnar1)
   05160 Hepatitis C
    15975 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    15975 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15975 (Ifnar1)
   05169 Epstein-Barr virus infection
    15975 (Ifnar1)
   05165 Human papillomavirus infection
    15975 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15975 (Ifnar1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15975 (Ifnar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac fn3
Motif
Other DBs
NCBI-GeneID: 15975
NCBI-ProteinID: NP_034638
MGI: 107658
Ensembl: ENSMUSG00000022967
Vega: OTTMUSG00000027185
UniProt: P33896
LinkDB All DBs
Structure
PDB: 

Position
16 C3.3; 16 52.98 cM
AA seq 590 aa AA seqDB search
MLAVVGAAALVLVAGAPWVLPSAAGGENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTF
SAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPF
IPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTI
NSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQ
GKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPIPTCANVQTTHCVFSQDTVY
TGTFFLHVQASEGNHTSFWSEEKFIDSQKHILPPPPVITVTAMSDTLLVYVNCQDSTCDG
LNYEIIFWENTSNTKISMEKDGPEFTLKNLQPLTVYCVQARVLFRALLNKTSNFSEKLCE
KTRPGSFSTIWIITGLGVVFFSVMVLYALRSVWKYLCHVCFPPLKPPRSIDEFFSEPPSK
NLVLLTAEEHTERCFIIENTDTVAVEVKHAPEEDLRKYSSQTSQDSGNYSNEEEESVGTE
SGQAVLSKAPCGGPCSVPSPPGTLEDGTCFLGNEKYLQSPALRTEPALLC
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctgtcgtgggcgcggcggccctggtgctggtggccggggcgccttgggtgcta
ccctcagctgcaggtggagaaaatctgaaacctcctgagaatatagacgtctacattata
gatgacaactacaccctaaagtggagcagccacggagagtcaatgggcagtgtgaccttt
tcagcagaatatcgaacaaaagacgaggcgaagtggttaaaagtgcctgaatgtcaacat
actacaacgaccaagtgtgaattctctttactggacacaaatgtgtatatcaaaacacag
tttcgtgtcagagcagaggaagggaacagcacatcttcgtggaatgaggttgatccgttt
attccattctacacagctcacatgagccccccagaagtacgtttagaagctgaagataaa
gccatactagtccacatctctcctcccggacaagacgggaacatgtgggcactggagaaa
ccttccttcagttacaccatacgaatctggcagaagtcttccagtgacaaaaaaactatt
aactctacgtattatgtagaaaagataccagaactcttgccagagactacttactgttta
gaagttaaagcaatacatccgtcacttaagaaacacagcaattacagcactgtgcagtgt
ataagcaccacagtggcaaataaaatgcctgtgccaggaaatctccaagtggatgcccaa
ggcaagagctatgtcctgaaatgggactacattgcgtctgcagacgtgctcttcagggca
cagtggcttcctggctattcaaaaagcagttctggaagccgttcagataaatggaaacca
ataccaacctgtgcaaatgtccagactacgcactgtgtcttttctcaagatactgtctac
acaggaacgttctttctccatgtacaagcctcagagggaaatcacacatccttttggtct
gaagagaagtttattgattctcaaaaacacattctccctcctcctccggtcattactgtc
accgccatgagtgacaccttgcttgtttatgtcaactgtcaggacagcacatgtgatgga
ctcaattacgaaatcatcttttgggaaaacacttccaatactaagataagcatggagaag
gatggcccagagttcaccctcaagaacctgcagccgctgactgtgtactgtgtccaggcc
agagtgctcttcagggccctgctgaataagaccagcaacttcagtgaaaagctgtgtgag
aaaacacgtccaggaagtttttccacgatctggattataactggattaggtgttgtgttc
ttctctgtcatggtcctttatgctttgaggagcgtctggaaatacctgtgtcatgtgtgc
ttcccaccactcaagcctccccgcagtattgatgagtttttctctgagccgccttcaaaa
aaccttgtacttctgacggctgaggagcacacggaaagatgcttcatcattgagaataca
gacacggtcgctgtagaagtaaagcacgcgcctgaggaggacctcaggaagtacagctca
cagaccagccaggactcgggcaactattccaacgaagaggaggagagtgtgggcaccgag
agcggccaagctgtgctctccaaagctccctgcggggggccatgcagcgtgcctagccct
cctgggaccttggaagacgggacctgcttcctgggaaatgaaaaatatcttcagagccca
gccctgaggacagagccagctcttctctgctga

KEGG   Mus musculus (mouse): 15976Help
Entry
15976             CDS       T01002                                 

Gene name
Ifnar2, AI747302, Ifnar-2
Definition
(RefSeq) interferon (alpha and beta) receptor 2
  KO
K05131  interferon receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    15976 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    15976 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15976 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15976 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15976 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    15976 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    15976 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15976 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15976 (Ifnar2)
  09172 Infectious disease: viral
   05162 Measles
    15976 (Ifnar2)
   05164 Influenza A
    15976 (Ifnar2)
   05160 Hepatitis C
    15976 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    15976 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15976 (Ifnar2)
   05169 Epstein-Barr virus infection
    15976 (Ifnar2)
   05165 Human papillomavirus infection
    15976 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15976 (Ifnar2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15976 (Ifnar2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 15976
NCBI-ProteinID: NP_034639
MGI: 1098243
Ensembl: ENSMUSG00000022971
Vega: OTTMUSG00000040135
UniProt: O35664
LinkDB All DBs
Position
16 C3.3; 16 52.82 cM
AA seq 513 aa AA seqDB search
MRSRCTVSAVGLLSLCLVVSASLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKS
GPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTV
CRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDS
VRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSE
SAIVGITTSCLVVMVFVSTIVMLKRIGYICLKDNLPNVLNFRHFLTWIIPERSPSEAIDR
LEIIPTNKKKRLWNYDYEDGSDSDEEVPTASVTGYTMHGLTGKPLQQTSDTSASPEDPLH
EEDSGAEESDEAGAGAGAEPELPTEAGAGPSEDPTGPYERRKSVLEDSFPREDNSSMDEP
GDNIIFNVNLNSVFLRVLHDEDASETLSLEEDTILLDEGPQRTESDLRIAGGDRTQPPLP
SLPSQDLWTEDGSSEKSDTSDSDADVGDGYIMR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacggtgcaccgtctctgccgtcggtctcctcagcttgtgtcttgtggtgtct
gcgagcctagagactatcacaccgtctgcttttgatgggtatccagatgaaccttgcact
ataaacataacaatacgaaattcccggctaattttatcctgggaattagagaacaagtct
ggcccacccgctaactacaccctctggtacacagtcatgagcaaagacgaaaatctgacg
aaggttaagaactgttcagataccacgaagtcatcatgtgacgtgacagataagtggttg
gagggcatggagagctacgtcgtcgccatcgtcatagtgcacagaggggacttgaccgtg
tgccgctgctcagactacatcgtgcctgcaaacgctcctcttgagccgccagaatttgag
atcgttggctttacagaccacataaacgtgacgatggaatttccacctgtcacttccaaa
ataatccaggaaaagatgaagactacaccctttgtcatcaaagaacagataggggacagc
gttaggaagaagcacgagcccaaagtgaataatgtcactgggaacttcacatttgtcctt
agagacttacttccaaagacaaactactgtgtatctctttattttgatgatgaccccgca
ataaaatctcccttaaaatgcatcgtccttcagcctggccaggaatcaggattatcagaa
tctgctatagtaggaataactacttcgtgtttggtagtgatggttttcgtgagcactatc
gtaatgctgaaacggattggttatatatgcctaaaagacaatttgcccaatgtcttgaac
ttccgccactttttaacctggataatccctgaacggtcaccttcagaagccatcgatcgg
ctggaaatcatccccacaaacaagaagaagagactgtggaattacgattatgaggatggc
agtgacagtgacgaagaggtccccacagcaagtgtcactggctacaccatgcatggactg
acgggcaagcctctgcaacaaacctctgacacctcagccagccccgaggatcccctgcat
gaagaagattcaggcgctgaggaatctgatgaagctggagcaggggctggagctgagcca
gaactccccacagaggcgggggcggggccttcagaagaccccactggcccctatgagaga
agaaagagtgtgctcgaggactcattccccagggaggacaacagctccatggatgagcct
ggggacaacattatcttcaacgtgaacttaaactctgtgtttctgagggttctccatgat
gaagatgcctcagagacattatctctcgaagaagacaccatcctcctagacgaaggtccc
cagaggacagagtcagaccttcggatagctggtggggacaggacacagccgcccctcccc
agccttccttcccaggatctatggactgaagatgggtcatctgagaaatcagacacctca
gattccgatgctgatgtgggggacggctacatcatgagatga

KEGG   Mus musculus (mouse): 15979Help
Entry
15979             CDS       T01002                                 

Gene name
Ifngr1, CD119, IFN-gammaR, Ifgr, Ifngr, Nktar
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05132  Salmonella infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    15979 (Ifngr1)
   04066 HIF-1 signaling pathway
    15979 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15979 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15979 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15979 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    15979 (Ifngr1)
   04659 Th17 cell differentiation
    15979 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15979 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15979 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15979 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    15979 (Ifngr1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    15979 (Ifngr1)
   05152 Tuberculosis
    15979 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    15979 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    15979 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15979 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15979 (Ifngr1)
   05140 Leishmaniasis
    15979 (Ifngr1)
   05142 Chagas disease (American trypanosomiasis)
    15979 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15979 (Ifngr1)
   04090 CD molecules [BR:mmu04090]
    15979 (Ifngr1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15979 (Ifngr1)
CD molecules [BR:mmu04090]
 Proteins
  15979 (Ifngr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind DUF3827 Cation_efflux
Motif
Other DBs
NCBI-GeneID: 15979
NCBI-ProteinID: NP_034641
MGI: 107655
Ensembl: ENSMUSG00000020009
Vega: OTTMUSG00000035345
UniProt: P15261
LinkDB All DBs
Position
10 A3; 10 8.49 cM
AA seq 477 aa AA seqDB search
MGPQAAAGRMILLVVLMLSAKVGSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQ
NMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYA
RSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYT
VYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSK
DVCIPPFHDDRKDSIWILVVAPLTVFTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKS
ATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEELSKETKALEAG
GSTSAMTPDSPPTPTQRRSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLP
NNNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggcccgcaggcggcagctggcaggatgattctgctggtggtcctgatgctgtctgcg
aaggtcgggagtggagctttgacgagcactgaggatcctgagcctccctcggtgcctgta
ccgacgaatgttctaattaagtcttataacttgaaccctgtcgtatgctgggaataccag
aacatgtcacagactcctatttttactgtacaggtaaaggtgtattcgggttcctggact
gattcctgcaccaacatttctgatcattgttgtaatatctatgaacaaattatgtatcct
gatgtatctgcctgggccagagttaaagctaaggttggacaaaaagaatctgactatgca
cggtcaaaagagttccttatgtgcctaaagggaaaggtcgggccccctggcctggagatc
aggaggaagaaggaagaacagctctccgtcctcgtatttcaccctgaagtcgttgtgaat
ggagagagccagggaaccatgtttggtgacgggagcacctgttacacattcgactatact
gtgtatgtggagcataaccggagtggggagatcctacatacgaaacatacggtcgaaaaa
gaagagtgtaatgagactctgtgtgagttaaacatctcagtatccacactggattccaga
tattgtatttcagtagacggaatctcatctttctggcaagttagaacagaaaaatcgaaa
gacgtctgtatccctcctttccatgatgacagaaaggattcaatttggattctggtggtt
gctcctcttaccgtctttacagtagttatcctggtatttgcgtattggtatactaagaag
aattcattcaagagaaaaagcataatgttacctaagtccttgctctctgtggtaaaaagt
gccacgttagagacaaaacctgaatcgaagtattcacttgtcacaccgcaccagccagct
gtcctagagagtgagacggtgatctgtgaagagcccctgtccacagtgacagctccagac
agccccgaagcagcagaacaggaagaactttcaaaagaaacaaaggctctggaggctgga
ggaagcacgtctgccatgaccccagacagccctccaactccgacacaaagacgcagcttt
tccctgttaagtagtaaccagtcaggcccttgtagcctcaccgcctatcactcccgaaac
ggctctgacagtggcctcgtgggatcgggcagctccatatcggacttggaatctctccca
aacaacaactcagaaacaaagatggcagagcacgaccctccacccgtgagaaaggccccc
atggcctccggttatgacaaaccgcacatgttggtggacgtgcttgtggatgttgggggg
aaggagtctctcatggggtatagactcacaggagaggcccaggagctgtcctaa

KEGG   Mus musculus (mouse): 15980Help
Entry
15980             CDS       T01002                                 

Gene name
Ifngr2, Ifgr2, Ifgt
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05132  Salmonella infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    15980 (Ifngr2)
   04066 HIF-1 signaling pathway
    15980 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15980 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15980 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15980 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    15980 (Ifngr2)
   04659 Th17 cell differentiation
    15980 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15980 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15980 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15980 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    15980 (Ifngr2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    15980 (Ifngr2)
   05152 Tuberculosis
    15980 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    15980 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    15980 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15980 (Ifngr2)
   05140 Leishmaniasis
    15980 (Ifngr2)
   05142 Chagas disease (American trypanosomiasis)
    15980 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15980 (Ifngr2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15980 (Ifngr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Motif
Other DBs
NCBI-GeneID: 15980
NCBI-ProteinID: NP_032364
MGI: 107654
Ensembl: ENSMUSG00000022965
Vega: OTTMUSG00000028337
UniProt: Q63953
LinkDB All DBs
Position
16 C3.3; 16 53.07 cM
AA seq 332 aa AA seqDB search
MRPLPLWLPSLLLCGLGAAASSPDSFSQLAAPLNPRLHLYNDEQILTWEPSPSSNDPRPV
VYQVEYSFIDGSWHRLLEPNCTDITETKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSK
WVGLEPFQHYENVTVGPPKNISVTPGKGSLVIHFSPPFDVFHGATFQYLVHYWEKSETQQ
EQVEGPFKSNSIVLGNLKPYRVYCLQTEAQLILKNKKIRPHGLLSNVSCHETTANASARL
QQVILIPLGIFALLLGLTGACFTLFLKYQSRVKYWFQAPPNIPEQIEEYLKDPDQFILEV
LDKDGSPKEDSWDSVSIISSPEKERDDVLQTP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctttgccactgtggctgccgtcgctgctgctctgtgggctcggtgccgcggcg
tcctcgccagactcgttttcccagcttgcggcccctctgaacccaaggcttcacctgtac
aatgatgagcagattctaacttgggagccgtcaccttccagcaatgacccaagaccagtg
gtctaccaggtggaatatagcttcatcgatggctcttggcataggttgctggagccgaac
tgtacggacatcacagagacaaagtgtgacttaacaggaggcggccgcttgaagcttttc
ccacacccattcacagtcttcctgcgggtgcgagccaagcgagggaacctcacttccaag
tgggtggggctggagccatttcaacactatgagaatgttactgttggacctccgaaaaac
atctcggtgaccccaggaaaaggttccctcgtcatacacttctcccctccctttgatgtg
ttccacggggcaacttttcagtatcttgtccactactgggaaaagtcagaaacccaacag
gaacaggttgaaggccctttcaagagcaactccattgtgctgggcaatctgaagccatac
agagtatattgtttacaaactgaggcacaactgattttgaaaaacaaaaaaatccgacca
catgggctcttgagcaatgtatcctgtcacgaaacaacagcaaatgcctccgccaggctg
cagcaagtcatcctgattccgttgggcatcttcgcattgctgctcggcctgacgggcgcc
tgcttcaccctgttcctcaaataccaaagccgagtgaagtactggtttcaggctccgcca
aacatcccggaacaaatcgaagagtatctaaaggacccagaccaattcatcttagaggtc
ttggacaaggacggttcaccgaaggaggactcctgggactccgtgtcaattatttcttct
ccagaaaaggagcgagatgatgtgctccaaacaccgtga

KEGG   Mus musculus (mouse): 16161Help
Entry
16161             CDS       T01002                                 

Gene name
Il12rb1, CD212, IL-12R[b]
Definition
(RefSeq) interleukin 12 receptor, beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16161 (Il12rb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16161 (Il12rb1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16161 (Il12rb1)
   04659 Th17 cell differentiation
    16161 (Il12rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16161 (Il12rb1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    16161 (Il12rb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16161 (Il12rb1)
   04090 CD molecules [BR:mmu04090]
    16161 (Il12rb1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16161 (Il12rb1)
CD molecules [BR:mmu04090]
 Proteins
  16161 (Il12rb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 16161
NCBI-ProteinID: NP_032379
MGI: 104579
Ensembl: ENSMUSG00000000791
Vega: OTTMUSG00000061579
UniProt: Q60837
LinkDB All DBs
Position
8 B3.3; 8 34.21 cM
AA seq 738 aa AA seqDB search
MDMMGLAGTSKHITFLLLCQLGASGPGDGCCVEKTSFPEGASGSPLGPRNLSCYRVSKTD
YECSWQYDGPEDNVSHVLWCCFVPPNHTHTGQERCRYFSSGPDRTVQFWEQDGIPVLSKV
NFWVESRLGNRTMKSQKISQYLYNWTKTTPPLGHIKVSQSHRQLRMDWNVSEEAGAEVQF
RRRMPTTNWTLGDCGPQVNSGSGVLGDIRGSMSESCLCPSENMAQEIQIRRRRRLSSGAP
GGPWSDWSMPVCVPPEVLPQAKIKFLVEPLNQGGRRRLTMQGQSPQLAVPEGCRGRPGAQ
VKKHLVLVRMLSCRCQAQTSKTVPLGKKLNLSGATYDLNVLAKTRFGRSTIQKWHLPAQE
LTETRALNVSVGGNMTSMQWAAQAPGTTYCLEWQPWFQHRNHTHCTLIVPEEEDPAKMVT
HSWSSKPTLEQEECYRITVFASKNPKNPMLWATVLSSYYFGGNASRAGTPRHVSVRNQTG
DSVSVEWTASQLSTCPGVLTQYVVRCEAEDGAWESEWLVPPTKTQVTLDGLRSRVMYKVQ
VRADTARLPGAWSHPQRFSFEVQISRLSIIFASLGSFASVLLVGSLGYIGLNRAAWHLCP
PLPTPCGSTAVEFPGSQGKQAWQWCNPEDFPEVLYPRDALVVEMPGDRGDGTESPQAAPE
CALDTRRPLETQRQRQVQALSEARRLGLAREDCPRGDLAHVTLPLLLGGVTQGASVLDDL
WRTHKTAEPGPPTLGQEA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggacatgatggggctggcagggaccagcaaacacatcaccttcctcctgctttgccag
ctaggcgcctcaggcccaggtgatggctgctgcgttgagaagacatcgttcccagaggga
gcctcaggctcacccttaggacccaggaacttgagttgctacagggtttccaagacagac
tatgagtgctcctggcagtatgatggccctgaggacaatgtttctcacgtcctgtggtgc
tgctttgtccctccgaaccatacccacaccggccaggagcgctgccgctacttctcctca
ggcccagaccgcactgtgcagttctgggaacaggacggtatccctgtgctgtccaaggtc
aacttctgggtggagtctcggcttgggaaccgaaccatgaagtcccagaagatatcccag
tacctgtacaactggaccaagacgacccctcccctgggacacatcaaggtgtcacaatca
caccggcagttgcgaatggactggaatgtgtctgaagaggccggtgctgaggtacagttc
aggcgccgtatgcccacaacgaattggaccttgggtgactgcggacctcaggttaactct
ggctcaggtgtgcttggtgacattcgtgggagcatgtctgagtcctgcctctgcccttct
gagaacatggcccaagagatccagatacggaggaggaggcggctctcctcaggagcccct
ggaggtccctggagtgattggagcatgcctgtgtgtgttccacctgaagtccttccccag
gccaagattaagttcttggtggagcccctgaaccaaggtggaaggaggcgtctaaccatg
caaggacagtcaccacagctggcagtcccggaaggctgccgaggcaggcctggtgcgcag
gtgaagaagcacttggtgctggtgcgcatgctgtcctgcaggtgccaggctcagacctcg
aagaccgtgcccctgggcaagaagctgaacctctccggggccacctatgacctgaatgtg
ctcgccaaaactcgtttcggtcgcagcaccatccagaagtggcaccttcctgcccaagag
ctcacagagacaagagccctgaatgtcagcgtgggaggcaacatgacatccatgcagtgg
gcagcccaggctcccggcaccacctactgccttgagtggcagccatggttccagcacagg
aaccacacacactgtaccctgattgtaccagaagaagaggatcctgccaagatggtgaca
cacagctggagctctaaacctaccctggagcaggaggaatgttaccgcatcacagtgttc
gcctccaagaaccccaagaatcccatgctgtgggccacagtcctgtccagttactacttt
gggggtaacgcctcgagagccggtactccacgacacgtgtcggtgaggaaccaaaccggg
gactcggtgtccgtggagtggacggcgtcacagctgagcacctgcccgggggtcctgacg
caatacgtcgtgcgctgcgaggctgaagacggcgcgtgggagtcagagtggctcgtgcca
cccactaaaacccaagtgacacttgacggactgcgcagccgagtaatgtacaaggttcag
gtgcgagccgacactgcgaggctcccgggtgcctggagtcatccccagcgctttagcttt
gaggtgcagatttcccgtttatccatcattttcgcgtctctgggaagcttcgccagcgtc
ctcctcgtgggcagtctcggatacattggcttaaacagggccgcctggcacttgtgccca
cccctgcctacaccctgtggcagcactgccgtggagttccctggcagccagggcaagcag
gcttggcagtggtgcaaccctgaggacttcccggaggtgttgtacccgcgagatgcgctg
gtggtcgagatgcccggagacagaggcgacgggacagagtcgccccaggccgcccctgag
tgcgccctggacacaaggcggcccttggagactcagaggcagaggcaggtgcaggcactg
tcagaggccaggcgcctgggcctggctagggaggactgtccccgtggtgacctggcccac
gtgacactcccgctgctcctgggaggtgtgacccagggagcctctgtacttgacgatctt
tggaggacccataagactgcggagccgggaccgcccactttggggcaagaggcctga

KEGG   Mus musculus (mouse): 16162Help
Entry
16162             CDS       T01002                                 

Gene name
Il12rb2, A930027I18Rik, IL-12RB2, Ifnm
Definition
(RefSeq) interleukin 12 receptor, beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16162 (Il12rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16162 (Il12rb2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16162 (Il12rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16162 (Il12rb2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    16162 (Il12rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16162 (Il12rb2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16162 (Il12rb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Lep_receptor_Ig Tissue_fac Pur_ac_phosph_N IL6Ra-bind ObR_Ig DUF1035
Motif
Other DBs
NCBI-GeneID: 16162
NCBI-ProteinID: NP_032380
MGI: 1270861
Ensembl: ENSMUSG00000018341
Vega: OTTMUSG00000029293
UniProt: P97378
LinkDB All DBs
Position
6 C1; 6 30.81 cM
AA seq 874 aa AA seqDB search
MAQTVRECSLALLFLFMWLLIKANIDVCKLGTVTVQPAPVIPLGSAANISCSLNPKQGCS
HYPSSNELILLKFVNDVLVENLHGKKVHDHTGHSSTFQVTNLSLGMTLFVCKLNCSNSQK
KPPVPVCGVEISVGVAPEPPQNISCVQEGENGTVACSWNSGKVTYLKTNYTLQLSGPNNL
TCQKQCFSDNRQNCNRLDLGINLSPDLAESRFIVRVTAINDLGNSSSLPHTFTFLDIVIP
LPPWDIRINFLNASGSRGTLQWEDEGQVVLNQLRYQPLNSTSWNMVNATNAKGKYDLRDL
RPFTEYEFQISSKLHLSGGSWSNWSESLRTRTPEEEPVGILDIWYMKQDIDYDRQQISLF
WKSLNPSEARGKILHYQVTLQEVTKKTTLQNTTRHTSWTRVIPRTGAWTASVSAANSKGA
SAPTHINIVDLCGTGLLAPHQVSAKSENMDNILVTWQPPKKADSAVREYIVEWRALQPGS
ITKFPPHWLRIPPDNMSALISENIKPYICYEIRVHALSESQGGCSSIRGDSKHKAPVSGP
HITAITEKKERLFISWTHIPFPEQRGCILHYRIYWKERDSTAQPELCEIQYRRSQNSHPI
SSLQPRVTYVLWMTAVTAAGESPQGNEREFCPQGKANWKAFVISSICIAIITVGTFSIRY
FRQKAFTLLSTLKPQWYSRTIPDPANSTWVKKYPILEEKIQLPTDNLLMAWPTPEEPEPL
IIHEVLYHMIPVVRQPYYFKRGQGFQGYSTSKQDAMYIANPQATGTLTAETRQLVNLYKV
LESRDPDSKLANLTSPLTVTPVNYLPSHEGYLPSNIEDLSPHEADPTDSFDLEHQHISLS
IFASSSLRPLIFGGERLTLDRLKMGYDSLMSNEA
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggcacagactgttagagaatgctcattggcacttctttttttgttcatgtggctgctg
attaaagcaaatatagatgtgtgcaagcttggcactgtgaccgtccagcctgcccctgtg
attcctcttgggtcagctgccaatatttcctgctccttgaatcccaagcaaggctgttca
cattatcccagttctaacgaattaatcctcttaaagtttgtcaatgatgtccttgttgaa
aatctccatggcaagaaagtccatgaccacactggtcactcctccacttttcaagtcacc
aacctgtcccttggtatgaccttgtttgtctgcaagctaaactgtagcaactctcaaaag
aagccaccagtcccagtatgtggggtggagatctcagttggtgttgctccagagccacct
caaaacatatcatgtgtccaggaaggagaaaatggaactgtggcctgttcctggaactct
ggaaaagttacttatctgaaaaccaattacactttacagttaagtggaccaaacaatctg
acctgtcagaaacaatgtttttctgacaatcgtcagaattgcaatcgcctggatcttggg
atcaatctaagccctgatttagctgaatccaggttcatagtccgtgttactgccatcaac
gatcttggaaattcttcttcacttccgcatacgttcacgttcttggacatagtgatccct
cttcctccgtgggacatcagaatcaactttctaaatgcttctgggagcagaggtacactg
cagtgggaagatgaggggcaagtggtactcaatcaactcagatatcagcctcttaacagc
acgtcctggaacatggtcaatgctacaaatgccaaaggaaaatatgacctgcgagatctg
agaccgtttacagaatatgaatttcaaatctcctctaagctacatctctctggaggaagt
tggagtaattggagtgagtcactgagaacacgaacaccagaggaagagcctgttgggata
ttagacatctggtacatgaaacaagacatcgactatgacagacagcagatctctcttttc
tggaagagtctgaatccatcagaggcaagggggaagatcctccactatcaggtgacgtta
caagaggtgacaaagaaaacaacactgcagaatactacaagacacacctcctggaccagg
gtcatcccccgaactggggcttggacggcatcagtgtctgcagccaactcaaaaggcgct
tctgcacccactcacattaacatagtggacctatgtggcactgggttgctggctcctcac
caggtctctgcaaagtcggagaacatggacaacattctagtgacctggcagcctcctaag
aaagctgattctgctgttcgggagtacatagtggaatggagagctctccaaccagggagc
atcacgaagtttcccccacactggctgcggatccccccggacaacatgtctgctctgatt
tcagagaacataaagccctatatctgttatgaaatcagggtgcatgcactgtcagagagc
caaggagggtgcagctccatccggggtgactccaagcacaaagcaccagtgagtggccct
cacattactgccatcacagagaaaaaggaacgccttttcatttcctggacccacattcca
ttcccggagcaaaggggctgcatcctccattacagaatatactggaaagaacgagactcg
acagcacaacctgagctctgcgaaattcagtaccgacgctctcaaaactcacatccaata
agcagcctacagcccagggtgacatatgtcctatggatgacagctgtgacagctgctggt
gaaagtccccaaggaaatgaaagggaattttgtccacagggcaaagccaactggaaagca
ttcgtgatatcaagcatttgcatcgctatcatcacggtgggcacgttctcaattcgttac
ttccggcaaaaggcatttactctcctgtctactctcaaacctcaatggtatagcagaacc
attccagatccagcaaacagcacttgggtaaagaagtatcccattctggaggagaagatc
cagctacctacggataatctcctgatggcatggcccactcctgaagagcctgagcccctg
atcatccatgaagtcctctaccacatgatcccagttgtcagacaaccatattacttcaaa
agaggccaaggattccaaggctactctacctccaagcaagatgcaatgtatattgccaat
ccacaagctacaggaactctcacagctgagaccagacaactagtgaacctatacaaggtg
ctagaaagcagagaccctgactcaaaactggccaacctgaccagccccttgacagtcacc
ccagtgaactaccttcctagccatgaaggctatttaccctccaacatagaagatctgtca
ccacatgaggctgacccaactgattcttttgacctggagcatcaacatatttctctttcc
atttttgcatcaagttctctccgcccactcatcttcggtggtgagcggctgactctagat
cggttaaagatgggctatgactccctcatgagtaatgaggcttga

KEGG   Mus musculus (mouse): 16164Help
Entry
16164             CDS       T01002                                 

Gene name
Il13ra1, AI882074, CD213a1, IL-13R-alpha-1, IL-13r[a], Il13ra, NR4
Definition
(RefSeq) interleukin 13 receptor, alpha 1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16164 (Il13ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16164 (Il13ra1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16164 (Il13ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16164 (Il13ra1)
   04090 CD molecules [BR:mmu04090]
    16164 (Il13ra1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16164 (Il13ra1)
CD molecules [BR:mmu04090]
 Proteins
  16164 (Il13ra1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind Tissue_fac LIFR_D2 LIFR_N
Motif
Other DBs
NCBI-GeneID: 16164
NCBI-ProteinID: NP_598751
MGI: 105052
Ensembl: ENSMUSG00000017057
Vega: OTTMUSG00000017214
UniProt: O09030 Q8BNM4
LinkDB All DBs
Position
X A3.3; X 20.49 cM
AA seq 424 aa AA seqDB search
MARPALLGELLVLLLWTATVGQVAAATEVQPPVTNLSVSVENLCTIIWTWSPPEGASPNC
TLRYFSHFDDQQDKKIAPETHRKEELPLDEKICLQVGSQCSANESEKPSPLVKKCISPPE
GDPESAVTELKCIWHNLSYMKCSWLPGRNTSPDTHYTLYYWYSSLEKSRQCENIYREGQH
IACSFKLTKVEPSFEHQNVQIMVKDNAGKIRPSCKIVSLTSYVKPDPPHIKHLLLKNGAL
LVQWKNPQNFRSRCLTYEVEVNNTQTDRHNILEVEEDKCQNSESDRNMEGTSCFQLPGVL
ADAVYTVRVRVKTNKLCFDDNKLWSDWSEAQSIGKEQNSTFYTTMLLTIPVFVAVAVIIL
LFYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQSKEETDSVVLIENLK
KAAP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggccagcgctgctgggcgagctgttggtgctgctactgtggaccgccaccgtg
ggccaagttgccgcggccacagaagttcagccacctgtgacgaatttgagcgtctctgtc
gaaaatctctgcacgataatatggacgtggagtcctcctgaaggagccagtccaaattgc
actctcagatattttagtcactttgatgaccaacaggataagaaaattgctccagaaact
catcgtaaagaggaattacccctggatgagaaaatctgtctgcaggtgggctctcagtgt
agtgccaatgaaagtgagaagcctagccctttggtgaaaaagtgcatctcaccccctgaa
ggtgatcctgagtccgctgtgactgagctcaagtgcatttggcataacctgagctatatg
aagtgttcctggctccctggaaggaatacaagccctgacacacactatactctgtactat
tggtacagcagcctggagaaaagtcgtcaatgtgaaaacatctatagagaaggtcaacac
attgcttgttcctttaaattgactaaagtggaacctagttttgaacatcagaacgttcaa
ataatggtcaaggataatgctgggaaaattaggccatcctgcaaaatagtgtctttaact
tcctatgtgaaacctgatcctccacatattaaacatcttctcctcaaaaatggtgcctta
ttagtgcagtggaagaatccacaaaattttagaagcagatgcttaacttatgaagtggag
gtcaataatactcaaaccgaccgacataatattttagaggttgaagaggacaaatgccag
aattccgaatctgatagaaacatggagggtacaagttgtttccaactccctggtgttctt
gccgacgctgtctacacagtcagagtaagagtcaaaacaaacaagttatgctttgatgac
aacaaactgtggagtgattggagtgaagcacagagtataggtaaggagcaaaactccacc
ttctacaccaccatgttactcaccattccagtctttgtcgcagtggcagtcataatcctc
cttttttacctgaaaaggcttaagatcattatatttcctccaattcctgatcctggcaag
atttttaaagaaatgtttggagaccagaatgatgataccctgcactggaagaagtatgac
atctatgagaaacaatccaaagaagaaacggattctgtagtgctgatagaaaacctgaag
aaagcagctccttga

KEGG   Mus musculus (mouse): 16169Help
Entry
16169             CDS       T01002                                 

Gene name
Il15ra, AA690181, IL-15RA
Definition
(RefSeq) interleukin 15 receptor, alpha chain
  KO
K05074  interleukin 15 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16169 (Il15ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16169 (Il15ra)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    16169 (Il15ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16169 (Il15ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16169 (Il15ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16169 (Il15ra)
   04090 CD molecules [BR:mmu04090]
    16169 (Il15ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16169 (Il15ra)
CD molecules [BR:mmu04090]
 Proteins
  16169 (Il15ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi DUF3180 Mqo
Motif
Other DBs
NCBI-GeneID: 16169
NCBI-ProteinID: NP_032384
MGI: 104644
Ensembl: ENSMUSG00000023206
Vega: OTTMUSG00000011178
UniProt: Q60819
LinkDB All DBs
Structure
PDB: 

Position
2 A1; 2 8.97 cM
AA seq 263 aa AA seqDB search
MASPQLRGYGVQAIPVLLLLLLLLLLPLRVTPGTTCPPPVSIEHADIRVKNYSVNSRERY
VCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQP
ESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAAT
MTLEPTASTSLRITEISPHSSKMTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVE
VETMETVPMTVRASSKEDEDTGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgccgcagctccggggctatggagtccaggccattcctgtgttgctgctgctg
ctgttgctactgttgctcccgctgagggtgacgccgggcaccacgtgtccacctcccgta
tctattgagcatgctgacatccgggtcaagaattacagtgtgaactccagggagaggtat
gtctgtaactctggctttaagcggaaagctggaacatccaccctgattgagtgtgtgatc
aacaagaacacaaatgttgcccactggacaactcccagcctcaagtgcatcagagacccc
tccctagctcactacagtccagtgccaacagtagtgacaccaaaggtgacctcacagcca
gagagcccctccccctctgcaaaagagccagaagctttctctcccaaatcagataccgca
atgaccacagagacagctattatgcctggctccaggctgacaccatcccaaacaacttct
gcaggaactacagggacaggcagtcacaagtcctcccgagccccatctcttgcagcaaca
atgaccttggagcctacagcctccacctccctcaggataacagagatttctccccacagt
tccaaaatgacgaaagtggccatctctacatcggtcctcttggttggtgcaggggttgtg
atggctttcctggcctggtacatcaaatcaaggcagccttctcagccgtgccgtgttgag
gtggaaaccatggaaacagtaccaatgactgtgagggccagcagcaaggaggatgaagac
acaggagcctaa

KEGG   Mus musculus (mouse): 16184Help
Entry
16184             CDS       T01002                                 

Gene name
Il2ra, CD25, Il2r, Ly-43
Definition
(RefSeq) interleukin 2 receptor, alpha chain
  KO
K05068  interleukin 2 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16184 (Il2ra)
   04151 PI3K-Akt signaling pathway
    16184 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16184 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16184 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16184 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16184 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    16184 (Il2ra)
   04659 Th17 cell differentiation
    16184 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16184 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16184 (Il2ra)
   05162 Measles
    16184 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16184 (Il2ra)
   04090 CD molecules [BR:mmu04090]
    16184 (Il2ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16184 (Il2ra)
CD molecules [BR:mmu04090]
 Proteins
  16184 (Il2ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi DUF4834
Motif
Other DBs
NCBI-GeneID: 16184
NCBI-ProteinID: NP_032393
MGI: 96549
Ensembl: ENSMUSG00000026770
Vega: OTTMUSG00000011179
UniProt: P01590 Q544I2
LinkDB All DBs
Position
2 A1; 2 8.91 cM
AA seq 268 aa AA seqDB search
MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKE
LVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGH
CREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTC
VDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVA
SCLFLLISILLLSGLTWQHRWRKSRRTI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagccacgcttgctgatgttggggtttctctcattaaccatagtacccagttgtcgg
gcagaactgtgtctgtatgacccacccgaggtccccaatgccacattcaaagccctctcc
tacaagaacggcaccatcctaaactgtgaatgcaagagaggtttccgaagactaaaggaa
ttggtctatatgcgttgcttaggaaactcctggagcagcaactgccagtgcaccagcaac
tcccatgacaaatcgagaaagcaagttacagctcaacttgaacaccagaaagagcaacaa
accacaacagacatgcagaagccaacacagtctatgcaccaagagaaccttacaggtcac
tgcagggagccacctccttggaaacatgaagattccaagagaatctatcatttcgtggaa
ggacagagtgttcactacgagtgtattccgggatacaaggctctacagagaggtcctgct
attagcatctgcaagatgaagtgtgggaaaacggggtggactcagccccagctcacatgt
gtagatgaaagagaacaccaccgatttctggctagtgaggaatctcaaggaagcagaaat
tcttctcccgagagtgagacttcctgccccataaccaccacagacttcccacaacccaca
gaaacaactgcaatgacggagacatttgtgctcacaatggagtataaggtagcagtggcc
agctgcctcttcctgctcatcagcatcctcctcctgagcgggctcacctggcaacacaga
tggaggaagagcagaagaaccatctag

KEGG   Mus musculus (mouse): 16185Help
Entry
16185             CDS       T01002                                 

Gene name
Il2rb, CD122, IL-15Rbeta, IL15Rbeta, Il-2/15Rbeta, Il-2Rbeta, p70
Definition
(RefSeq) interleukin 2 receptor, beta chain
  KO
K05069  interleukin 2 receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16185 (Il2rb)
   04151 PI3K-Akt signaling pathway
    16185 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16185 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16185 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16185 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16185 (Il2rb)
   04659 Th17 cell differentiation
    16185 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16185 (Il2rb)
   05202 Transcriptional misregulation in cancer
    16185 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16185 (Il2rb)
   05162 Measles
    16185 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16185 (Il2rb)
   04090 CD molecules [BR:mmu04090]
    16185 (Il2rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16185 (Il2rb)
CD molecules [BR:mmu04090]
 Proteins
  16185 (Il2rb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2RB_N1 fn3
Motif
Other DBs
NCBI-GeneID: 16185
NCBI-ProteinID: NP_032394
MGI: 96550
Ensembl: ENSMUSG00000068227
UniProt: P16297
LinkDB All DBs
Structure
PDB: 

Position
15 E1; 15 37.52 cM
AA seq 539 aa AA seqDB search
MATIALPWSLSLYVFLLLLATPWASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCH
VHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRV
KTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWE
DASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
ILPMSWLRYLLLVLGCFSGFFSCVYILVKCRYLGPWLKTVLKCHIPDPSEFFSQLSSQHG
GDLQKWLSSPVPLSFFSPSGPAPEISPLEVLDGDSKAVQLLLLQKDSAPLPSPSGHSQAS
CFTNQGYFFFHLPNALEIESCQVYFTYDPCVEEEVEEDGSRLPEGSPHPPLLPLAGEQDD
YCAFPPRDDLLLFSPSLSTPNTAYGGSRAPEERSPLSLHEGLPSLASRDLMGLQRPLERM
PEGDGEGLSANSSGEQASVPEGNLHGQDQDRGQGPILTLNTDAYLSLQELQAQDSVHLI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggctaccatagctcttccctggagcctgtccctctacgtcttcctcctgctcctggct
acaccttgggcatctgcagcagtgaaaaactgttcccatcttgaatgcttctacaactca
agagccaatgtctcttgcatgtggagccatgaagaggctctgaatgtcacaacctgccac
gtccatgccaagtcgaacctgcgacactggaacaaaacctgtgagctaactcttgtgagg
caggcatcctgggcctgcaacctgatcctcgggtcgttcccagagtcccagtcactgacc
tccgtggacctccttgacataaatgtggtgtgctgggaagagaagggttggcgtagggta
aagacctgcgacttccatccctttgacaaccttcgcctggtggcccctcattccctccaa
gttctgcacattgatacccagagatgtaacataagctggaaggtctcccaggtctctcac
tacattgaaccatacttggaatttgaggcccgtagacgtcttctgggccacagctgggag
gatgcatccgtattaagcctcaagcagagacagcagtggctcttcttggagatgctgatc
cctagtacctcatatgaggtccaggtgagggtcaaagctcaacgaaacaataccgggacc
tggagtccctggagccagcccctgacctttcggacaaggccagcagatcccatgaaggag
atcctccccatgtcatggctcagataccttctgctggtccttggttgtttttctggcttc
ttctcctgcgtctacattttggtcaagtgccggtaccttgggccatggctgaagacagtt
ctcaagtgccacatcccagatccttctgagttcttctcccagctgagctcccagcatggg
ggagaccttcagaaatggctctcctcgcctgtccccttgtccttcttcagccccagtggc
cctgcccctgagatctctccgctggaagtgctcgacggagattccaaggccgtgcagctg
ctcctgttacagaaggactctgcccctttaccctcgcccagcggccactcacaggccagc
tgcttcaccaaccagggctacttcttcttccatctgcccaatgccttggagatcgaatcc
tgccaggtgtacttcacctatgacccctgtgtggaagaggaggtggaggaggatgggtca
aggctgcccgagggatctccccacccacctctgctgcctctggctggagaacaggatgac
tactgtgccttcccgcccagggatgacctgctgctcttctccccgagcctcagcaccccc
aacactgcctatgggggcagcagagcccctgaagaaagatctccactctccctgcatgag
ggacttccctccctagcatcccgtgacctgatgggcttacagcgccctctggagcggatg
ccggaaggtgatggagaggggctgtctgccaatagctctggggagcaggccagtgtccca
gaaggcaaccttcatgggcaagatcaggacagaggccagggccccatcctgaccctgaac
accgatgcctatctgtctcttcaagaactacaggcccaagattcagtccacctaatatag

KEGG   Mus musculus (mouse): 16186Help
Entry
16186             CDS       T01002                                 

Gene name
Il2rg, CD132, [g]c, gamma(c), gc, p64
Definition
(RefSeq) interleukin 2 receptor, gamma chain
  KO
K05070  interleukin 2 receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16186 (Il2rg)
   04151 PI3K-Akt signaling pathway
    16186 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16186 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16186 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16186 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16186 (Il2rg)
   04659 Th17 cell differentiation
    16186 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16186 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    16186 (Il2rg)
   05340 Primary immunodeficiency
    16186 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16186 (Il2rg)
   05162 Measles
    16186 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16186 (Il2rg)
   04090 CD molecules [BR:mmu04090]
    16186 (Il2rg)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16186 (Il2rg)
CD molecules [BR:mmu04090]
 Proteins
  16186 (Il2rg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N Interfer-bind IL2RB_N1 Tissue_fac
Motif
Other DBs
NCBI-GeneID: 16186
NCBI-ProteinID: NP_038591
MGI: 96551
Ensembl: ENSMUSG00000031304
Vega: OTTMUSG00000018211
UniProt: P34902 Q3UPA9
LinkDB All DBs
Structure
PDB: 

Position
X D; X 43.9 cM
AA seq 369 aa AA seqDB search
MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEV
QCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIK
ERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSK
WSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLV
TEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPP
PCYSLKPEA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactattattgtcacctagatccttcttagtccttcagctgctcctgctgagg
gcagggtggagctccaaggtcctcatgtccagtgcgaatgaagacatcaaagctgatttg
atcctgacttctacagcccctgaacacctcagtgctcctactctgccccttccagaggtt
cagtgctttgtgttcaacatagagtacatgaattgcacttggaatagcagttctgagcct
caggcaaccaacctcacgctgcactataggtacaaggtatctgataataatacattccag
gagtgcagtcactatttgttctccaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagctccaggacccccagaaaccccagagg
cgagctgtacagaagctaaacctacagaatcttgtgatcccacgggctccagaaaatcta
acactcagcaatctgagtgaatcccagctagagctgagatggaaaagcagacatattaaa
gaacgctgtttacaatacttggtgcagtaccggagcaacagagatcgaagctggacggaa
ctaatagtgaatcatgaacctagattctccctgcctagtgtggatgagctgaaacggtac
acatttcgggttcggagccgctataacccaatctgtggaagttctcaacagtggagtaaa
tggagccagcctgtccactgggggagtcatactgtagaggagaatccttccttgtttgca
ctggaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtg
tactgttggttggaacgaatgcctccaattccccccatcaagaatctagaggatctggtt
actgaataccaagggaacttttcggcctggagtggtgtgtctaaagggctgactgagagt
ctgcagccagactacagtgaacggttctgccacgtcagcgagattccccccaaaggaggg
gccctaggagaggggcctggaggttctccttgcagcctgcatagcccttactggcctccc
ccatgttattctctgaagccggaagcctga

KEGG   Mus musculus (mouse): 16188Help
Entry
16188             CDS       T01002                                 

Gene name
Il3ra, CD123, CDw123, SUT-1
Definition
(RefSeq) interleukin 3 receptor, alpha chain
  KO
K04737  interleukin 3 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16188 (Il3ra)
   04151 PI3K-Akt signaling pathway
    16188 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16188 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    16188 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16188 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16188 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16188 (Il3ra)
   04090 CD molecules [BR:mmu04090]
    16188 (Il3ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16188 (Il3ra)
CD molecules [BR:mmu04090]
 Proteins
  16188 (Il3ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind IL3Ra_N
Motif
Other DBs
NCBI-GeneID: 16188
NCBI-ProteinID: NP_032395
MGI: 96553
Ensembl: ENSMUSG00000068758
UniProt: P26952
LinkDB All DBs
Position
14 A1; 14 7.08 cM
AA seq 396 aa AA seqDB search
MAANLWLILGLLASHSSDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGA
FCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAA
QDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAP
HGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPT
LTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFR
VKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLL
YRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaacctgtggctcatcctggggctcctggcatcccactcttcagatctggct
gcggtccgtgaggctccacccactgctgtgaccacgcccatccagaacctgcatatcgac
cccgcccactacacactgagctgggaccccgcccccggcgctgacatcacgacaggggct
ttttgcaggaagggcagggacatctttgtctgggctgaccccgggcttgcccgctgctca
ttccagtcgctctccctctgccatgtgaccaacttcaccgtcttcctggggaaggacagg
gctgtggcaggatccatccagttccccccagatgatgatggcgaccacgaggccgcagcc
caggacctgcgctgctgggtgcatgaggggcagctgagctgccaatgggagcggggtccg
aaagcaacgggtgacgtgcactaccggatgttctggcgtgatgtgcggctcggtcctgcc
cacaaccgcgagtgtccacactaccacagccttgatgtcaacaccgctggccccgcccct
catggtggccatgaaggctgcacccttgacctcgacactgtccttggctccacccccaac
agccctgaccttgtcccccaggtcaccatcaccgtcaacggcagtggccgcgctggcccc
gtgccctgcatggacaacactgtggacctgcagcgcgcagaggtcctggccccgcccacg
ttgacagtggagtgcaacggctctgaggcccatgcccgatgggtcgcgcggaacagattc
caccatggcctccttgggtacaccctgcaggtcaaccagagctcccgctcagagccacag
gaatacaatgtctccatcccccacttctgggtccccaacgctggtgccatctccttccgg
gtcaagtcgaggtcagaggtttaccctcggaagctcagcagctggagcgaagcctggggc
ctcgtctgccccccagaggtgatgcctgtgaagacagccttggtgacttcagtggctacg
gtgctgggggcagggctcgtggcagctgggctcctgctgtggtggaggaagtcgctgctc
taccgcctgtgcccacccattccacgcctgcgcctgcccttggcaggggagatggtcgtg
tgggaaccagctcttgaagactgcgaggtgacgcctgtgacagacgcctga

KEGG   Mus musculus (mouse): 16190Help
Entry
16190             CDS       T01002                                 

Gene name
Il4ra, CD124, Il4r
Definition
(RefSeq) interleukin 4 receptor, alpha
  KO
K05071  interleukin 4 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16190 (Il4ra)
   04151 PI3K-Akt signaling pathway
    16190 (Il4ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16190 (Il4ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16190 (Il4ra)
   04658 Th1 and Th2 cell differentiation
    16190 (Il4ra)
   04659 Th17 cell differentiation
    16190 (Il4ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16190 (Il4ra)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    16190 (Il4ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16190 (Il4ra)
   04090 CD molecules [BR:mmu04090]
    16190 (Il4ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16190 (Il4ra)
CD molecules [BR:mmu04090]
 Proteins
  16190 (Il4ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4Ra_N
Motif
Other DBs
NCBI-GeneID: 16190
NCBI-ProteinID: NP_001008700
MGI: 105367
Ensembl: ENSMUSG00000030748
Vega: OTTMUSG00000058201
UniProt: P16382 Q3U905
LinkDB All DBs
Position
7 F3; 7 68.94 cM
AA seq 810 aa AA seqDB search
MGRLCTKFLTSVGCLILLLVTGSGSIKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCL
HYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSG
NVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTY
KEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQRLPLGVTI
SCLCIPLFCLFCYFSITKIKKIWWDQIPTPARSPLVAIIIQDAQVPLWDKQTRSQESTKY
PHWKTCLDKLLPCLLKHRVKKKTDFPKAAPTKSLQSPGKAGWCPMEVSRTVLWPENVSVS
VVRCMELFEAPVQNVEEEEDEIVKEDLSMSPENSGGCGFQESQADIMARLTENLFSDLLE
AENGGLGQSALAESCSPLPSGSGQASVSWACLPMGPSEEATCQVTEQPSHPGPLSGSPAQ
SAPTLACTQVPLVLADNPAYRSFSDCCSPAPNPGELAPEQQQADHLEEEEPPSPADPHSS
GPPMQPVESWEQILHMSVLQHGAAAGSTPAPAGGYQEFVQAVKQGAAQDPGVPGVRPSGD
PGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELSPS
PLNSDPPKSPPECLGLELGLKGGDWVKAPPPADQVPKPFGDDLGFGIVYSSLTCHLCGHL
KQHHSQEEGGQSPIVASPGCGCCYDDRSPSLGSLSGALESCPEGIPPEANLMSAPKTPSN
LSGEGKGPGHSPVPSQTTEVPVGALGIAVS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctttgcaccaagttcctgacctctgtgggctgtctgattttgctgttggtg
actggatctgggagcatcaaggtcctgggtgagcccacctgcttctctgactacatccgc
acttccacgtgtgagtggttcctggatagcgctgtggactgcagttctcagctctgccta
cactacaggctgatgttcttcgagttctctgaaaacctcacatgcatcccgaggaacagt
gccagcactgtgtgtgtgtgccacatggaaatgaataggccggtccaatcagacagatac
cagatggaactgtgggctgagcacagacagctgtggcagggctccttcagccccagtggt
aatgtgaagcccctagctccagacaacctcacactccacaccaatgtgtccgacgaatgg
ctgctgacctggaataacctgtacccatcgaacaacttactgtacaaagacctcatctcc
atggtcaacatctccagagaggacaaccctgcagaattcatagtctataatgtgacctac
aaggaacccaggctgagcttcccgatcaacatcctgatgtcaggggtctactatacggcg
cgtgtgagggtcagatcccagatactcactggcacctggagtgagtggagtcctagcatc
acgtggtacaaccacttccagctgcccctgatacagcgccttccactgggggtcaccatc
tcctgcctctgcatcccgttgttttgcctgttctgttacttcagcattaccaagattaag
aagatatggtgggaccagattcccaccccagcacgcagtcccttggtggccatcatcatt
caggatgcacaggtgcccctctgggataagcagacccgaagccaggagtcaaccaagtac
ccgcactggaaaacttgtctagacaagctgctgccttgcttgctgaagcacagagtaaag
aagaagacagacttcccgaaggctgccccaaccaagtctctccagagtcctggaaaggca
ggctggtgtcccatggaggtcagcaggaccgtcctctggccagagaatgttagtgtcagt
gtggtgcgctgtatggagctgtttgaggccccagtacagaatgtggaggaggaagaagat
gagatagtcaaagaggacctgagcatgtcacctgagaacagcggaggctgcggcttccag
gagagccaggcagacatcatggctcggctcactgagaacctgttttccgacttgttggag
gctgagaatgggggccttggccagtcagccttggcagagtcatgctcccctctgccttca
ggaagtgggcaggcttctgtatcctgggcctgcctccccatggggcccagtgaggaggcc
acatgccaggtcacagagcagccttcacacccaggccctctttcaggcagcccagcccag
agtgcacctactctggcttgcacgcaggtcccacttgtccttgcagacaatcctgcctac
cggagttttagtgactgctgtagcccggccccaaatcctggagagctggctccagagcag
cagcaggctgatcatctggaagaagaggagcctccaagcccggctgacccccattcttca
gggccaccaatgcagccagtggagagctgggagcagatccttcacatgagtgtcctgcag
catggggcagctgctggctccaccccagcccctgccggtggctaccaggagtttgtgcag
gcagtgaagcagggtgccgcccaggatcctggggtgcctggtgtcaggccttctggagac
cccggttacaaggccttctcgagcctgctcagcagcaatggcatccgcggggacacagca
gcagcggggactgacgatgggcatggaggctacaagcccttccagaatcctgttcctaac
cagtcccctagctccgtgcccttatttactttcggactagacacggagctgtcacccagt
cctctgaactcagacccacccaaaagccccccagaatgccttggtctggagctggggctc
aaaggaggtgactgggtgaaggcccctcctcctgcagatcaggtgcccaagccctttggg
gatgacctgggctttggtattgtgtactcgtccctcacttgccacttgtgtggccacctg
aagcaacaccacagccaggaggaaggtggccagagccccatcgttgctagccctggctgt
ggctgctgctacgatgacagatcaccatccctggggagcctctcgggggccttggaaagc
tgtcctgagggaataccaccagaagccaacctcatgtcagcacccaagacaccctcaaac
ttgtcaggggagggcaagggccctggtcactctcctgttcccagccagacgaccgaggtg
cctgtgggcgccctgggcattgctgtttcttag

KEGG   Mus musculus (mouse): 16192Help
Entry
16192             CDS       T01002                                 

Gene name
Il5ra, CD125, CDw125, Il5r
Definition
(RefSeq) interleukin 5 receptor, alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16192 (Il5ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16192 (Il5ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16192 (Il5ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16192 (Il5ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16192 (Il5ra)
   04090 CD molecules [BR:mmu04090]
    16192 (Il5ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16192 (Il5ra)
CD molecules [BR:mmu04090]
 Proteins
  16192 (Il5ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind Tissue_fac fn3 Il13Ra_Ig EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 16192
NCBI-ProteinID: NP_032396
MGI: 96558
Ensembl: ENSMUSG00000005364
Vega: OTTMUSG00000056402
UniProt: P21183 Q05A81
LinkDB All DBs
Position
6 E1; 6 49.19 cM
AA seq 415 aa AA seqDB search
MVPVLLILVGALATLQADLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDL
EYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPG
SPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQ
EYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPR
NVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVST
YSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLIVLPTAACFVLLIFSLICRV
CHLWTRLFPPVPAPKSNIKDLPVVTEYEKPSNETKIEVVHCVEEVGFEVMGNSTF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgtgttactaattcttgtgggagctttggcaacactgcaagctgacttactt
aatcacaaaaagtttttacttctaccacctgtcaattttaccattaaagccactggatta
gctcaagttcttttacactgggacccaaatcctgaccaagagcaaaggcatgttgatcta
gagtatcacgtgaaaataaatgccccacaagaagacgaatatgataccagaaagactgaa
agcaaatgtgtgaccccccttcatgaaggctttgcagctagcgtgaggaccattctgaag
agcagccatacaactctggccagcagttgggtttctgctgaactcaaagctccaccagga
tctcctggaacctcggttacgaatttaacttgtaccacacacactgttgtaagtagccac
acccacttaaggccataccaagtgtcccttcgttgcacctggcttgttgggaaggatgcc
cctgaggacacacagtatttcctatactacaggtttggtgttttgactgaaaaatgccaa
gaatacagcagagatgcactgaacagaaatactgcatgctggtttcccaggacatttatc
aacagcaaagggtttgagcagcttgctgtgcacattaatggctcaagcaagcgtgctgca
atcaagccctttgatcagctgttcagtccacttgccattgaccaagtgaatcctccaagg
aatgtcacagtggaaattgaaagcaattctctctatatacagtgggagaaaccactttct
gcctttccagatcattgctttaactatgagctgaaaatttacaacacaaaaaatggtcac
attcagaaggaaaaactgatcgccaataagttcatctcaaaaattgatgatgtttctaca
tattccattcaagtgagagcagctgtgagctcaccttgcagaatgccaggaaggtggggc
gagtggagtcaacctatttatgtgggaaaggaaaggaagtccttggtagaatggcatctc
attgtgctcccaacagccgcctgcttcgtcttgttaatcttctcactcatctgcagagtg
tgtcatctatggaccaggttgtttccaccggttccggccccaaagagtaacatcaaagat
ctccctgtggttactgaatatgagaaaccttcgaatgaaaccaaaattgaagttgtacat
tgtgtggaagaggttggatttgaagtcatgggaaattccacgttttga

KEGG   Mus musculus (mouse): 16194Help
Entry
16194             CDS       T01002                                 

Gene name
Il6ra, CD126, IL-6R, IL-6R-alpha, IL-6RA, Il6r
Definition
(RefSeq) interleukin 6 receptor, alpha
  KO
K05055  interleukin 6 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04659  Th17 cell differentiation
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16194 (Il6ra)
   04066 HIF-1 signaling pathway
    16194 (Il6ra)
   04151 PI3K-Akt signaling pathway
    16194 (Il6ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16194 (Il6ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16194 (Il6ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16194 (Il6ra)
   04659 Th17 cell differentiation
    16194 (Il6ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16194 (Il6ra)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16194 (Il6ra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16194 (Il6ra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16194 (Il6ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16194 (Il6ra)
   04090 CD molecules [BR:mmu04090]
    16194 (Il6ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16194 (Il6ra)
CD molecules [BR:mmu04090]
 Proteins
  16194 (Il6ra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind ig Ig_3 fn3 Ig_6 V-set I-set Ig_5
Motif
Other DBs
NCBI-GeneID: 16194
NCBI-ProteinID: NP_034689
MGI: 105304
Ensembl: ENSMUSG00000027947
Vega: OTTMUSG00000052883
UniProt: P22272 Q3URV7
LinkDB All DBs
Position
3 F1; 3 39.19 cM
AA seq 460 aa AA seqDB search
MLTVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHW
VYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRK
NPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEG
DKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPET
WDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQW
SEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSS
MSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPLKPTFLL
VPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtcggctgcacgctgttggtcgccctgctggccgcgcccgcggtcgcgctg
gtcctcgggagctgccgcgcgctggaggtggcaaatggcacagtgacaagcctgccaggg
gccaccgttaccctgatttgccccgggaaggaagcagcaggcaatgttaccattcactgg
gtgtactctggctcacaaaacagagaatggactaccacaggaaacacactggttctgagg
gacgtgcagctcagcgacactggggactatttatgctccctgaatgatcacctggtgggg
actgtgcccttgctggtggatgttcccccagaggagcccaagctctcctgcttccggaag
aacccccttgtcaacgccatctgtgagtggcgtccgagcagcaccccctctccaaccacg
aaggctgtgctgtttgcaaagaaaatcaacaccaccaacgggaagagtgacttccaggtg
ccctgtcagtattctcagcagctgaaaagcttctcctgccaggtggagatcctggagggt
gacaaagtataccacatagtgtcactgtgcgttgcaaacagtgtgggaagcaagtccagc
cacaacgaagcgtttcacagcttaaaaatggtgcagccggatccacctgccaaccttgtg
gtatcagccatacctggaaggccgcgctggctcaaagtcagctggcagcaccctgagacc
tgggacccgagttactacttgctgcagttccagcttcgataccgacctgtatggtcaaag
gagttcacggtgttgctgctcccggtggcccagtaccaatgcgtcatccatgatgccttg
cgaggagtgaagcacgtggtccaggtccgtgggaaggaggagcttgaccttggccagtgg
agcgaatggtccccagaggtcacgggcactccttggatagcagagcccaggaccaccccg
gcaggaatcctctggaaccccacacaggtctctgttgaagactctgccaaccacgaggat
cagtacgaaagttctacagaagcaacgagtgtcctcgccccagtgcaagaatcctcgtcc
atgtccctgcccacattcctggtagctggaggaagcttggcgtttgggttgcttctctgt
gtcttcatcatcctgagactcaagcagaaatggaagtcagaggctgagaaggaaagcaag
acgacctctcctccacccccaccgtattccttgggcccactgaagccgaccttccttctg
gttcctctcctcaccccacacagctctgggtctgacaataccgtaaaccacagctgcctg
ggtgtcagggacgcacagagcccttatgacaacagcaacagagactacttattccccaga
taa

KEGG   Mus musculus (mouse): 16195Help
Entry
16195             CDS       T01002                                 

Gene name
Il6st, 5133400A03Rik, AA389424, BB405851, CD130, D13Ertd699e, gp130
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  Jak-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16195 (Il6st)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16195 (Il6st)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16195 (Il6st)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16195 (Il6st)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    16195 (Il6st)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16195 (Il6st)
   05203 Viral carcinogenesis
    16195 (Il6st)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    16195 (Il6st)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16195 (Il6st)
   04090 CD molecules [BR:mmu04090]
    16195 (Il6st)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16195 (Il6st)
CD molecules [BR:mmu04090]
 Proteins
  16195 (Il6st)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind fn3_2 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 16195
NCBI-ProteinID: NP_034690
MGI: 96560
Ensembl: ENSMUSG00000021756
Vega: OTTMUSG00000044624
UniProt: Q00560 Q6PDI9
LinkDB All DBs
Position
13 D2.2; 13 63.73 cM
AA seq 917 aa AA seqDB search
MSAPRIWLAQALLFFLTTESIGQLLEPCGYIYPEFPVVQRGSNFTAICVLKEACLQHYYV
NASYIVWKTNHAAVPREQVTVINRTTSSVTFTDVVLPSVQLTCNILSFGQIEQNVYGVTM
LSGFPPDKPTNLTCIVNEGKNMLCQWDPGRETYLETNYTLKSEWATEKFPDCQSKHGTSC
MVSYMPTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTPPYNLSVTNSEELSSILKL
SWVSSGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTSFTVQDLKPFTEYVFRIRSI
KDSGKGYWSDWSEEASGTTYEDRPSRPPSFWYKTNPSHGQEYRSVRLIWKALPLSEANGK
ILDYEVILTQSKSVSQTYTVTGTELTVNLTNDRYVASLAARNKVGKSAAAVLTIPSPHVT
AAYSVVNLKAFPKDNLLWVEWTPPPKPVSKYILEWCVLSENAPCVEDWQQEDATVNRTHL
RGRLLESKCYQITVTPVFATGPGGSESLKAYLKQAAPARGPTVRTKKVGKNEAVLAWDQI
PVDDQNGFIRNYSISYRTSVGKEMVVHVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGGKD
GPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSH
IAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANNKKPCPDDLKSVDLFKKEKVSTE
GHSSGIGGSSCMSSSRPSISSNEENESAQSTASTVQYSTVVHSGYRHQVPSVQVFSRSES
TQPLLDSEERPEDLQLVDSVDGGDEILPRQPYFKQNCSQPEACPEISHFERSNQVLSGNE
EDFVRLKQQQVSDHISQPYGSEQRRLFQEGSTADALGTGADGQMERFESVGMETTIDEEI
PKSYLPQTVRQGGYMPQ
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaccaaggatttggctagcgcaagctttgctttttttcctcaccactgaatct
ataggtcaacttttggaaccgtgtggttacatctaccctgaatttccagttgtccagcgc
ggctcgaacttcactgccatttgtgtgctgaaggaggcgtgtctgcagcattactacgtg
aatgccagctacatcgtgtggaagaccaaccatgctgctgttcccagggagcaggtcact
gtcatcaacagaaccacgtccagtgtcacgttcacagacgtggtcctcccgagcgtgcag
ctcacctgcaacatcctgtcctttgggcagatcgagcagaatgtgtatggagtcaccatg
ctttcaggctttcctccagataaacctacaaatttgacttgcattgtgaatgaggggaag
aatatgctgtgccagtgggaccccggaagggagacttaccttgaaacaaactacactttg
aaatcagagtgggcaacagagaagtttcctgattgccagtcaaagcatggcacttcatgt
atggtcagctacatgcccacctattatgtcaacattgaagtctgggtggaagcagagaat
gcccttgggaaggtctcctcagagtctatcaattttgaccccgtggataaagtgaaaccc
accccaccatataatttatcagtgaccaactcagaagaattatccagtatattaaagcta
tcatgggtcagttcagggctgggcggtcttttagatctaaagtctgacatccaatatagg
accaaagatgcctcaacttggatccaggtccctcttgaagatacaatgtctcctcgaact
tccttcactgtgcaggacctcaagccttttacagaatatgtgtttaggatccggtccatt
aaggacagtgggaagggctactggagtgactggagtgaggaggctagtgggaccacatac
gaagacagaccatccagaccaccaagtttctggtataagacaaatccatcccatgggcag
gaatatagatctgtacggctcatatggaaggcactgcctctttctgaagccaatgggaaa
atcttggattatgaagtgattcttacgcagtcaaagtccgtctcacaaacgtacacagtc
actggcacagagctgaccgtgaatctcaccaatgaccgctatgtcgcgtctctagcagca
agaaacaaggtgggcaaatcagctgcagctgtcctcaccatccccagcccccacgtcaca
gctgcttattctgtagtgaatcttaaagcatttccaaaagataacctgctctgggtggaa
tggacacctccacctaaacccgtgagcaagtacatcttagagtggtgtgtgttgtcagag
aacgcaccctgtgttgaagactggcagcaggaagacgctaccgtgaatcggacccacttg
agaggacgcctcctggagagcaagtgctatcaaatcacagtaactcccgtattcgccacg
gggcccggaggctctgagtccttgaaggcgtacctcaaacaagccgctcctgccagagga
ccgactgttcggacaaagaaagtggggaaaaatgaagctgtcttagcgtgggaccagatt
cctgtggacgaccagaatggcttcattagaaactactccatatcttacagaaccagcgtg
ggaaaggagatggttgtgcatgtggattcttctcacacggagtacacgctgtcctctctg
agtagtgatacgttgtacatggtccgaatggccgcgtacacagatgaaggtgggaaagat
gggccggaattcacttttacaacaccaaagttcgctcaaggagaaatagaagccatagtc
gtgcctgtgtgcttagccttcctcctgacaaccctgctgggcgtcttgttctgctttaac
aaacgagacctaattaaaaaacacatctggcctaatgttcctgatccttccaagagtcat
attgcccagtggtcacctcacacccccccaaggcacaattttaactccaaagatcaaatg
tactcggacggcaatttcactgatgtaagcgttgtggaaatagaagcaaacaacaagaag
ccttgtccagatgacctgaagtccgtggacctgttcaagaaggagaaagtgagtacagaa
gggcacagcagtggcatcgggggctcttcatgcatgtcctcctccaggcccagcatctcc
agcaacgaggagaatgagtctgctcagagcaccgccagcacggtgcagtactccactgtg
gtgcacagcggctacaggcaccaggtcccgtccgtgcaagtgttctcaaggtccgagtcc
acccagcccctgctagactcggaggagcggccagaagacctgcagctggtggatagtgta
gacggtggggatgagatcttgcccaggcaaccgtatttcaagcagaactgcagtcagcct
gaagcctgtccagagatttcacattttgaaaggtcaaaccaggttttgtccggcaatgag
gaggattttgtcagactgaagcagcagcaggtttcagatcacatttctcagccctatgga
tccgagcaacggaggctgtttcaggaaggctctacagcggatgctcttggcacgggggct
gatggacagatggagagatttgaatctgttggaatggagaccacaattgatgaagaaatt
cccaaaagttacttgccacagactgtaagacaaggtggctacatgccgcagtga

KEGG   Mus musculus (mouse): 16197Help
Entry
16197             CDS       T01002                                 

Gene name
Il7r, CD127, IL-7Ralpha
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16197 (Il7r)
   04068 FoxO signaling pathway
    16197 (Il7r)
   04151 PI3K-Akt signaling pathway
    16197 (Il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16197 (Il7r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16197 (Il7r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16197 (Il7r)
  09163 Immune disease
   05340 Primary immunodeficiency
    16197 (Il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16197 (Il7r)
   04090 CD molecules [BR:mmu04090]
    16197 (Il7r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16197 (Il7r)
CD molecules [BR:mmu04090]
 Proteins
  16197 (Il7r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FN3_7 fn3
Motif
Other DBs
NCBI-GeneID: 16197
NCBI-ProteinID: NP_032398
MGI: 96562
Ensembl: ENSMUSG00000003882
UniProt: P16872 Q8C9W4 Q5FW78
LinkDB All DBs
Structure
PDB: 

Position
15 A1; 15 4.16 cM
AA seq 459 aa AA seqDB search
MMALGRAFAIVFCLIQAVSGESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLLTCAFN
DSDINTANLEFQICGALLRVKCLTLNKLQDIYFIKTSEFLLIGSSNICVKLGQKNLTCKN
MAINTIVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYLKKVKHDVAYRPARGESNWTH
VSLFHTRTTIPQRKLRPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETPEPKNQGGWDP
VLPSVTILSLFSVFLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKTSLNVSFNP
ESFLDCQIHEVKGVEARDEVESFLPNDLPAQPEELETQGHRAAVHSANRSPETSVSPPET
VRRESPLRCLARNLSTCNAPPLLSSRSPDYRDGDRNRPPVYQDLLPNSGNTNVPVPVPQP
LPFQSGILIPVSQRQPISTSSVLNQEEAYVTMSSFYQNK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatggctctgggtagagctttcgctatagttttctgcttaattcaagctgtttctgga
gaaagtggaaatgcccaggatggagacctagaagatgcagacgcggacgatcactccttc
tggtgccacagccagttggaagtggatggaagtcaacatttattgacttgtgcttttaat
gactcagacatcaacacagctaatctggaatttcaaatatgtggggctcttttacgagtg
aaatgcctaactcttaacaagctgcaagatatatattttataaagacatcagaattctta
ctgattggtagcagcaatatatgtgtgaagcttggacaaaagaatttaacttgcaaaaat
atggctataaacacaatagttaaagccgaggctccctctgacctgaaagtcgtttatcgc
aaagaagcaaatgattttttggtgacatttaatgcacctcacttgaaaaagaaatattta
aaaaaagtaaagcatgatgtggcctaccgcccagcaaggggtgaaagcaactggacgcat
gtatctttattccacacaagaacaacaatcccacagagaaaactacgaccaaaagcaatg
tatgaaatcaaagtccgatccattccccataacgattacttcaaaggcttctggagcgag
tggagtccaagttctaccttcgaaactccagaacccaagaatcaaggaggatgggatcct
gtcttgccaagtgtcaccattctgagtttgttctctgtgtttttgttggtcatcttagcc
catgtgctatggaaaaaaaggattaaacctgtcgtatggcctagtctccccgatcataag
aaaactctggaacaactatgtaagaagccaaaaacgagtctgaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatgaggtgaaaggcgttgaagccagggacgaggtg
gaaagttttctgcccaatgatcttcctgcacagccagaggagttggagacacagggacac
agagccgctgtacacagtgcaaaccgctcgcctgagacttcagtcagcccaccagaaaca
gttagaagagagtcacccttaagatgcctggctagaaatctgagtacctgcaatgcccct
ccactcctttcctctaggtcccctgactacagagatggtgacagaaataggcctcctgtg
tatcaagacttgctgccaaactctggaaacacaaatgtccctgtccctgtccctcaacca
ttgcctttccagtcgggaatcctgataccagtttctcagagacagcccatctccacttcc
tcagtactgaatcaagaagaagcgtatgtcaccatgtctagtttttaccaaaacaaatga

KEGG   Mus musculus (mouse): 209590Help
Entry
209590            CDS       T01002                                 

Gene name
Il23r, IL-23R
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    209590 (Il23r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    209590 (Il23r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    209590 (Il23r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    209590 (Il23r)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    209590 (Il23r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    209590 (Il23r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   209590 (Il23r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 IL6Ra-bind IL12p40_C IL2RB_N1 Pur_ac_phosph_N ObR_Ig
Motif
Other DBs
NCBI-GeneID: 209590
NCBI-ProteinID: NP_653131
MGI: 2181693
Ensembl: ENSMUSG00000049093
Vega: OTTMUSG00000029859
UniProt: Q8K4B4 G5E8U4
LinkDB All DBs
Position
6; 6 C1
AA seq 659 aa AA seqDB search
MKREREMRGFYYIWDMSHLTLQLHVVIALYVLFRWCHGGITSINCSGDMWVEPGEIFQMG
MNVSIYCQEALKHCRPRNLYFYKNGFKEEFDITRINRTTARIWYKGFSEPHAYMHCTAEC
PGHFQETLICGKDISSGHPPDAPSNLTCVIYEYSGNMTCTWNTGKPTYIDTKYIVHVKSL
ETEEEQQYLASSYVKISTDSLQGSRKYLVWVQAVNSLGMENSQQLHVHLDDIVIPSASII
SRAETTNDTVPKTIVYWKSKTMIEKVFCEMRYKTTTNQTWSVKEFDANFTYVQQSEFYLE
PDSKYVFQVRCQETGKRNWQPWSSPFVHQTSQETGKRNWQPWSSPFVHQTSQTVSQVTAK
SSHEPQKMEMLSATIFRGHPASGNHQDIGLLSGMVFLAIMLPIFSLIGIFNRSLRIGIKR
KVLLMIPKWLYEDIPNMENSNVAKLLQEKSVFENDNASEQALYVDPVLTEISEISPLEHK
PTDYKEERLTGLLETRDCPLGMLSTSSSVVYIPDLNTGYKPQVSNVPPGGNLFINRDERD
PTSLETTDDHFARLKTYPNFQFSASSMALLNKTLILDELCLVLNQGEFNSLDIKNSRQEE
TSIVLQSDSPSETIPAQTLLSDEFVSCLAIGNEDLPSINSYFPQNVLESHFSRISLFQK
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagagagagaaatgagaggcttctactacatttgggacatgagtcacctcaca
cttcagctgcatgtggtgatagccctttatgtgctcttcagatggtgtcacggaggaatc
acaagtataaactgctctggtgacatgtgggttgagcctggtgaaatttttcagatgggc
atgaatgtttctatatattgccaagaagcccttaagcactgccgaccaaggaatctttac
ttttataaaaatggcttcaaagaagaatttgatatcacaaggattaatagaacaacagct
cggatttggtataaaggcttttcggaacctcatgcctatatgcattgcactgctgaatgt
cctggtcattttcaagagacactgatttgtgggaaagacatttcctctggacatccaccg
gatgcccccagcaatctgacatgtgtcatttatgaatactcaggcaacatgacatgcacc
tggaacactgggaagcctacctacatagataccaagtatattgtgcatgtgaagagtttg
gagacagaagaagaacaacaatatcttgcctcaagctatgttaagatctccactgactca
ctgcaaggcagcaggaagtatttggtatgggtccaagctgtcaattccctaggcatggag
aactcacaacaactacacgtccatctggatgatatagtgataccttctgcgtccatcatt
tccagggctgagactacaaacgatactgtacccaagaccatagtttactggaaaagcaaa
actatgattgagaaagtattctgtgagatgagatacaaaacaacaacaaaccaaacgtgg
agtgttaaagaatttgacgccaatttcacatatgtacagcagtcagaattctacctggag
ccagacagcaagtatgtatttcaagtgcgatgtcaagaaactggtaaaagaaactggcag
ccttggagttccccctttgtccaccaaacttcccaagaaactggtaaaagaaactggcag
ccttggagttccccctttgtccaccaaacttcccagacagtttcccaggttacagcaaaa
tcatcccacgaacctcagaagatggagatgctcagtgctacaatcttcagaggacatcct
gcttcaggtaatcatcaagacattggacttttgtcgggaatggtcttcttggccatcatg
ttgccgattttttctctgattgggatatttaacagatcacttcgaataggaattaaaaga
aaagttttactgatgatcccaaagtggctttatgaagatattcctaatatggaaaatagc
aatgttgcaaaattattacaggaaaaaagtgtatttgagaatgataatgccagtgagcag
gccctgtatgtggatcctgtccttacagagataagtgaaatctctcccctggaacacaaa
cccacagattacaaagaagaaaggctcacaggactccttgagacaagagactgtcctcta
ggaatgttgtctaccagttcttctgttgtgtatattcctgacctcaacactggatacaaa
ccccaggtttcaaatgttcctcctggaggaaaccttttcattaacagagatgaaagagac
cctacatcccttgagaccacagatgaccactttgccagattgaaaacatatcccaacttc
caattttctgcttcaagtatggctttactaaacaaaacactaattcttgatgaattgtgc
ctcgttttaaatcaaggagaattcaattctcttgacataaaaaactcaagacaggaggaa
accagcatcgttttgcaaagtgactcacccagtgaaactatcccagcgcagactctgttg
tctgatgaatttgtctcctgtttggcaattgggaatgaagacttgccatctattaattct
tactttccacagaacgttttggaaagccatttcagtagaatttcactcttccaaaagtag

DBGET integrated database retrieval system