KEGG   Mus musculus (mouse): 12986Help
Entry
12986             CDS       T01002                                 

Gene name
Csf3r, Cd114, Csfgr, G-CSF-R, G-CSFR
Definition
(RefSeq) colony stimulating factor 3 receptor (granulocyte)
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    12986 (Csf3r)
   04151 PI3K-Akt signaling pathway
    12986 (Csf3r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12986 (Csf3r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12986 (Csf3r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12986 (Csf3r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   12986 (Csf3r)
CD molecules [BR:mmu04090]
 Proteins
  12986 (Csf3r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind ObR_Ig IL6Ra-bind DUF3102
Motif
Other DBs
NCBI-GeneID: 12986
NCBI-ProteinID: NP_031808
MGI: 1339755
Ensembl: ENSMUSG00000028859
Vega: OTTMUSG00000009297
UniProt: P40223
LinkDB All DBs
Structure
PDB: 

Position
4 D2.2; 4 59.77 cM
AA seq 837 aa AA seqDB search
MVGLGACTLTGVTLIFLLLPRSLESCGHIEISPPVVRLGDPVLASCTISPNCSKLDQQAK
ILWRLQDEPIQPGDRQHHLPDGTQESLITLPHLNYTQAFLFCLVPWEDSVQLLDQAELHA
GYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVA
KKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGP
DVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQ
APVYTLQMRCIRSSLPGFWSPWSPGLQLRPTMKAPTIRLDTWCQKKQLDPGTVSVQLFWK
PTPLQEDSGQIQGYLLSWSSPDHQGQDIHLCNTTQLSCIFLLPSEAQNVTLVAYNKAGTS
SPTTVVFLENEGPAVTGLHAMAQDLNTIWVDWEAPSLLPQGYLIEWEMSSPSYNNSYKSW
MIEPNGNITGILLKDNINPFQLYRITVAPLYPGIVGPPVNVYTFAGERAPPHAPALHLKH
VGTTWAQLEWVPEAPRLGMIPLTHYTIFWADAGDHSFSVTLNISLHDFVLKHLEPASLYH
VYLMATSRAGSTNSTGLTLRTLDPSDLNIFLGILCLVLLSTTCVVTWLCCKRRGKTSFWS
DVPDPAHSSLSSWLPTIMTEETFQLPSFWDSSVPSITKITELEEDKKPTHWDSESSGNGS
LPALVQAYVLQGDPREISNQSQPPSRTGDQVLYGQVLESPTSPGVMQYIRSDSTQPLLGG
PTPSPKSYENIWFHSRPQETFVPQPPNQEDDCVFGPPFDFPLFQGLQVHGVEEQGGF
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggtagggctgggagcctgcaccctgactggagttaccctgatcttcttgctactcccc
agaagtctggagagctgtggacacatcgagatttcaccccctgttgtccgcctgggggac
cctgtcctggcctcttgcaccatcagcccaaactgcagcaaactggaccaacaggcaaag
atcttatggagactgcaagatgagcccatccaacctggggacagacagcatcatctgcct
gatgggacccaagagtccctcatcactctgcctcacttgaactacacccaggccttcctc
ttctgcttagtgccatgggaagacagcgtccaactcctggatcaagctgagcttcacgca
ggctatccccctgccagcccctcaaacctatcctgcctcatgcacctcaccaccaacagc
ctggtctgccagtgggagccaggtcctgagacccacctgcccaccagcttcatcctaaag
agcttcaggagccgcgccgactgtcagtaccaaggggacaccatcccggattgtgtggca
aagaagaggcagaacaactgctccatcccccgaaaaaacttgctcctgtaccagtatatg
gccatctgggtgcaagcagagaatatgctagggtccagcgagtccccaaagctgtgcctc
gaccccatggatgttgtgaaattggagcctcccatgctgcaggccctggacattggccct
gatgtagtctctcaccagcctggctgcctgtggctgagctggaagccatggaagcccagt
gagtacatggaacaggagtgtgaacttcgctaccagccacagctcaaaggagccaactgg
actctggtgttccacctgccttccagcaaggaccagtttgagctctgcgggctccatcag
gccccagtctacaccctacagatgcgatgcattcgctcatctctgcctggattctggagc
ccctggagccccggcctgcagctgaggcctaccatgaaggcccccaccatcagactggac
acgtggtgtcagaagaagcaactagatccagggacagtgagtgtgcagctgttctggaag
ccaacgcccctgcaggaagacagtggacagatccagggctacctgctgtcctggagttcc
ccagatcatcaagggcaggacatacacctttgcaacaccacgcagctcagctgtatcttc
ctcctgccctcagaggcccagaacgtgacccttgtggcctacaacaaagcagggacctct
tcacctactacagtggttttcctggagaacgaaggtccagctgtgaccggactccatgcc
atggcccaagaccttaacaccatctgggtagactgggaagcccccagccttctgcctcag
ggctatctcattgagtgggaaatgagttctcccagctacaataacagctataagtcctgg
atgatagaacctaacgggaacatcactggaattctgttaaaggacaacataaatcccttt
cagctctacagaattacagtggctcccctgtacccaggcatcgtgggacctcctgtaaat
gtctacaccttcgctggagagagagctcctcctcatgctccagcgctgcatctaaagcat
gttggcacaacctgggcacagctggagtgggtacctgaggcccctaggctggggatgata
cccctcacccactacaccatcttctgggccgatgctggggaccactccttctccgtcacc
ctgaacatctccctccatgactttgtcctgaagcacctggagcccgccagtttgtatcat
gtctacctcatggccaccagtcgggcagggtccaccaacagtacaggccttaccctgagg
accctagatccatctgacttaaacattttcctgggcatactttgcttagtactcttgtcc
actacctgtgtagtgacctggctctgctgcaaacgcagaggaaagacttccttctggtca
gatgtgccagacccagcccacagtagcctgagctcctggttgcccaccatcatgacagag
gaaaccttccagttacccagcttctgggactccagcgtgccatcaatcaccaagatcact
gaactggaggaagacaagaaaccgacccactgggattccgaaagctctgggaatggtagc
cttccagccctggttcaggcctatgtgctccaaggagatccaagagaaatttccaaccag
tcccagcctccctctcgcactggtgaccaggtcctctatggtcaggtgcttgagagcccc
accagcccaggagtaatgcagtacattcgctctgactccactcagcccctcttggggggc
cccacccctagccctaaatcttatgaaaacatctggttccattcaagaccccaggagacc
tttgtgccccaacctccaaaccaggaagatgactgtgtctttgggcctccatttgatttt
cccctctttcaggggctccaggtccatggagttgaagaacaagggggtttctag

DBGET integrated database retrieval system