KEGG   Mus musculus (mouse): 12995Help
Entry
12995             CDS       T01002                                 

Gene name
Csnk2a1, CK2, Csnk2a1-rs4
Definition
(RefSeq) casein kinase 2, alpha 1 polypeptide
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05162  Measles
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    12995 (Csnk2a1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12995 (Csnk2a1)
   04064 NF-kappa B signaling pathway
    12995 (Csnk2a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    12995 (Csnk2a1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    12995 (Csnk2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    12995 (Csnk2a1)
  09172 Infectious disease: viral
   05162 Measles
    12995 (Csnk2a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12995 (Csnk2a1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    12995 (Csnk2a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12995 (Csnk2a1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  CK2 family
   12995 (Csnk2a1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Kinase
    12995 (Csnk2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Kinase-like Choline_kinase ABC1
Motif
Other DBs
NCBI-GeneID: 12995
NCBI-ProteinID: NP_031814
MGI: 88543
Ensembl: ENSMUSG00000074698
Vega: OTTMUSG00000015858
UniProt: Q60737
LinkDB All DBs
Position
2; 2 G3
AA seq 391 aa AA seqDB search
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMAGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggacccgtgccaagcagggccagagtttacacagatgttaacacacacagaccc
cgagagtactgggattatgaatcacatgtggtggaatgggggaatcaagatgactatcag
cttgttcgaaaattaggtaggggcaaatacagtgaagtgtttgaagccatcaacatcaca
aataatgaaaaagttgttgttaaaattctcaagccagtaaaaaagaagaaaattaagcgt
gaaataaagattttggagaatttgagaggtgggcccaacatcatcacacttgcagacatt
gtaaaagaccctgtgtcacgaacccctgccttggtttttgaacatgtaaacaacacagac
ttcaagcaattgtaccagacgttaacagactatgacattcgattttacatgtatgaaatt
ctgaaagccctggattattgtcacagcatggggattatgcacagagatgtgaaaccccat
aatgtcatgattgatcatgagcacagaaagcttcggctaatagactggggtttagctgag
ttttaccatccaggccaagagtataatgtccgagttgcttctcgatatttcaaaggtcca
gagctacttgtagattatcagatgtacgattatagtttggatatgtggagcttgggttgt
atgctggccagtatgatcttccggaaggagccatttttccatggacatgacaattatgat
cagttggtgaggatagccaaggttctgggaacagaagatttatatgactatattgacaag
tacaacattgaattagatccacgtttcaacgatatcttgggcagacactcccgtaagcga
tgggaacgctttgtccacagtgaaaaccagcatcttgtcagccctgaggccttggatttt
ctggacaagctgcttcgatatgaccaccagtcacggctcactgcaagagaggccatggag
cacccttacttctacactgttgtgaaggaccaggctcgaatgagttccactagcatggca
gggggcagcacacctgtcagcagcgccaatatgatgtcagggatttcttcagtgccaact
ccttcaccccttggacctctggcaggctcaccagtgattgccgctgccaactcacttggg
atacctgttccagctgctgctggcgctcagcagtaa

KEGG   Mus musculus (mouse): 13000Help
Entry
13000             CDS       T01002                                 

Gene name
Csnk2a2, 1110035J23Rik, C77789, CK2
Definition
(RefSeq) casein kinase 2, alpha prime polypeptide
  KO
K03097  casein kinase II subunit alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05162  Measles
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    13000 (Csnk2a2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13000 (Csnk2a2)
   04064 NF-kappa B signaling pathway
    13000 (Csnk2a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    13000 (Csnk2a2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    13000 (Csnk2a2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13000 (Csnk2a2)
  09172 Infectious disease: viral
   05162 Measles
    13000 (Csnk2a2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13000 (Csnk2a2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    13000 (Csnk2a2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13000 (Csnk2a2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  CK2 family
   13000 (Csnk2a2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Kinase
    13000 (Csnk2a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo Choline_kinase Kinase-like ABC1
Motif
Other DBs
NCBI-GeneID: 13000
NCBI-ProteinID: NP_034104
MGI: 88547
Ensembl: ENSMUSG00000046707
Vega: OTTMUSG00000061759
UniProt: O54833 Q545V8 Q8CDH5
LinkDB All DBs
Position
8 C5; 8 47.12 cM
AA seq 350 aa AA seqDB search
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNY
DQLVRIAKVLGTDELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCAENTVLSSGLTAAR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcccggccgcgggcagtcgggcccgggtctacgccgaggtgaacagcctgagg
agccgcgagtactgggactacgaagcccacgtcccgagctggggtaatcaagatgattac
caactggttcgaaaacttggtcggggcaagtatagtgaagtatttgaggccattaacatc
accaacaatgagagggtggttgtaaaaattctcaagccagtgaagaaaaagaagataaaa
cgagaggttaagattctggagaaccttcgtggtggaacaaatatcattaagctgattgac
actgtaaaggaccctgtgtcaaagacaccagctttggtatttgaatatatcaataataca
gattttaagcaactctaccagatcctgactgactttgatatccggttttatatgtatgaa
ctacttaaagctctggattactgccacagcaagggaatcatgcacagggatgtgaaacct
cacaatgtcatgatagatcaccaacaaaaaaagctccgactgattgattggggtctggca
gagttctatcatcctgctcaggagtacaatgttcgagtggcctcgaggtacttcaaggga
ccagagctccttgtggactatcagatgtatgattatagcttggacatgtggagcttgggc
tgcatgttagcgagcatgatattccgaaaggagccattcttccacgggcaggacaactat
gaccagcttgttcgaattgccaaggttctggggacagatgaactatatggttatctgaag
aagtaccacatagacctagatccacacttcaatgatatcctgggacaacattcacggaag
cgctgggaaaactttatccatagtgagaacaggcaccttgtcagcccggaggccctagat
cttcttgacaagctcctgcggtacgaccatcaacagagattgaccgccaaagaggccatg
gagcacccatatttctacccggtggtgaaggagcagtcccagccttgtgctgagaacacc
gtgctttccagtggtctcaccgcagcacgatga

KEGG   Mus musculus (mouse): 13001Help
Entry
13001             CDS       T01002                                 

Gene name
Csnk2b, CK_II_beta
Definition
(RefSeq) casein kinase 2, beta polypeptide
  KO
K03115  casein kinase II subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu04064  NF-kappa B signaling pathway
mmu04137  Mitophagy - animal
mmu04310  Wnt signaling pathway
mmu04520  Adherens junction
mmu05162  Measles
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    13001 (Csnk2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13001 (Csnk2b)
   04064 NF-kappa B signaling pathway
    13001 (Csnk2b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    13001 (Csnk2b)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    13001 (Csnk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13001 (Csnk2b)
  09172 Infectious disease: viral
   05162 Measles
    13001 (Csnk2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    13001 (Csnk2b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    13001 (Csnk2b)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   Kinase
    13001 (Csnk2b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     13001 (Csnk2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CK_II_beta CCDC24
Motif
Other DBs
NCBI-GeneID: 13001
NCBI-ProteinID: NP_001290374
MGI: 88548
Ensembl: ENSMUSG00000024387
Vega: OTTMUSG00000037175
UniProt: P67871
LinkDB All DBs
Position
17 B1; 17 18.59 cM
AA seq 215 aa AA seqDB search
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa
ttcttctgtgaggtggatgaagactacatccaggacaaatttaatcttactggactcaat
gagcaggtgcctcactatcgacaagctctggacatgatcttagacctggaacctgatgaa
gagctggaagacaaccccaaccagagcgacttgatcgaacaggcagctgagatgctttat
gggttgatccacgcccgctacatcctcaccaaccgaggcatcgcacaaatgttggaaaag
taccagcagggagactttggctactgtcctcgtgtatactgtgagaaccagccaatgctt
cctatcggcctttcagacatcccaggcgaggccatggtgaaactctactgccccaagtgc
atggacgtgtacacacccaagtcctccagacaccaccacacggacggcgcatacttcggc
actggtttccctcacatgctcttcatggtgcatccagagtaccggcccaagcgacctgcc
aaccagtttgtacccaggctctatggtttcaagatccatccaatggcttaccagctgcag
ctccaagccgccagcaacttcaagagcccagtcaagactattcgctga

DBGET integrated database retrieval system