KEGG   Mus musculus (mouse): 13016Help
Entry
13016             CDS       T01002                                 

Gene name
Ctbp1, BARS, CtBP3/BARS, D4S115h, D5H4S115, D5H4S115E
Definition
(RefSeq) C-terminal binding protein 1
  KO
K04496  C-terminal binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu05200  Pathways in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13016 (Ctbp1)
   04330 Notch signaling pathway
    13016 (Ctbp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13016 (Ctbp1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    13016 (Ctbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13016 (Ctbp1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Macropinocytosis
   Others
    13016 (Ctbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Cellsynth_D XdhC_C
Motif
Other DBs
NCBI-GeneID: 13016
NCBI-ProteinID: NP_038530
MGI: 1201685
Ensembl: ENSMUSG00000037373
Vega: OTTMUSG00000055360
UniProt: O88712
LinkDB All DBs
Position
5 B1; 5 17.52 cM
AA seq 441 aa AA seqDB search
MGSSHLLNKGLPLGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT
HWASMDPAVVHPELNGAAYSRYPPGVVSVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPH
APSPGQTVKPEADRDHTSDQL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctcccacttgctcaacaagggcctgccgctgggcgtccgacctcccatcatg
aacgggcccatgcacccccggcccctggtggcgctgctggatggccgggactgcacagtg
gagatgcctatcctgaaggatgtggccacagtagccttctgtgatgcacagtccacacag
gagatccatgagaaggtactgaatgaggctgtgggtgccctgatgtaccataccatcaca
ctgaccagagaagatctggagaagtttaaagctcttagaatcatcgtccgaattggcagc
gggtttgacaatatcgacatcaagtcagctggggatctaggcatcgcagtgtgcaatgtg
ccggcagcatctgtggaagaaacggcagactccaccctgtgccacatcctgaacctgtac
cgacgaaccacctggctacaccaggcccttcgggaaggcactcgagtccagagtgtagag
cagatccgagaggtggcttcaggagctgccaggatccgtggagagaccttgggcatcatt
ggactaggtcgtgtgggccaggcggtggcacttcgggcaaaggcttttggcttcaacgtc
ctcttctatgatccatacctatctgatggaatcgagcgggccctggggctacagcgcgtg
agcacgctgcaggacctgctcttccacagtgactgcgttaccctgcattgcggcctcaat
gagcacaaccaccacctcatcaatgactttactgtcaagcagatgagacaaggagccttt
ctggtgaacacagcccgtggtggcctggtggatgagaaggcactggcccaggccctgaag
gaagggcggatccgtggcgcagcgctggacgtgcatgagtcagagcccttcagctttagc
cagggacccttaaaggatgcacccaacctcatctgcacaccccatgctgcatggtacagt
gagcaggcgtccattgagatgagagaggaggcagcccgggaaatccggcgagccatcaca
ggccggatcccagatagcttgaaaaactgtgtcaacaaggaccacctgacagccgccacg
cactgggccagcatggaccctgctgtggtgcaccctgagctcaatggggctgcctacagc
aggtaccctccaggcgtcgtgagtgtggcccccactggcatcccagctgctgtggaaggg
attgttcccagtgccatgtccctgtctcatggcctgccccctgtggcccacccaccccac
gctccctctcctggccagactgtcaagcctgaggcggatagagaccatacgagtgaccag
ttgtag

KEGG   Mus musculus (mouse): 13017Help
Entry
13017             CDS       T01002                                 

Gene name
Ctbp2, AA407280, D7Ertd45e, Gtrgeo6, Ribeye
Definition
(RefSeq) C-terminal binding protein 2
  KO
K04496  C-terminal binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu05200  Pathways in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    13017 (Ctbp2)
   04330 Notch signaling pathway
    13017 (Ctbp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13017 (Ctbp2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    13017 (Ctbp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13017 (Ctbp2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Macropinocytosis
   Others
    13017 (Ctbp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 13017
NCBI-ProteinID: NP_034110
MGI: 1201686
Ensembl: ENSMUSG00000030970
Vega: OTTMUSG00000036726
UniProt: P56546 Q3UGL5
LinkDB All DBs
Position
7 F3; 7 76.32 cM
AA seq 445 aa AA seqDB search
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPPAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgtggataagcacaaagtcaagcggcagcgattggacaggatttgtgaaggt
atccgcccccagatcatgaacggccccctgcacccccgccccctggtggcactgctggat
ggcagagactgcactgtggagatgcccatcctgaaggacctggccactgtggccttctgt
gatgcacagtccactcaggaaatccatgagaaggtgttgaatgaggctgtgggtgccatg
atgtaccacaccatcaccctcaccagggaagacctggagaagttcaaggccctgagagtg
atcgtgcgaatcggtagtggctacgacaacgtggacatcaaggctgctggcgagctcggg
atcgctgtgtgcaacatcccatctgctgcagtggaggagacagcagattcgacagtctgc
cacattctcaatctgtatcggcggaacacatggctctaccaggccctccgagaaggcact
cgagtacagagtgtggaacagatccgtgaggtcgcctcaggagctgctcggatccgaggg
gaaacactgggcctcattggctttggtcgcacagggcaggcagttgctgttcgagccaag
gcctttggattcagcgtcatattttatgacccctacttacaggatgggatagaacgatct
ctgggcgtgcaaagggtctacaccctgcaggacttgctatatcagagcgactgcgtctcc
ttgcactgcaacctgaacgagcacaaccatcacctcatcaatgacttcactatcaagcag
atgaggcaaggtgcattccttgtgaatgcagcccgaggtggcctggtggatgagaaagcc
ttagctcaggccctcaaggagggcaggatacgaggagctgccctggatgtgcacgagtct
gagcccttcagcttcgcccagggcccattgaaggatgctccaaatctcatctgcacacca
cacacagcctggtacagtgaacaagcatcactagagatgagggaagcagcagccactgag
atccgccgagcaatcacaggtcgcatcccagaaagcttacgaaactgtgtcaacaaagaa
ttcttcgtgacttcagctccttggtcagtcattgaccagcaagcaattcaccccgagctc
aatggtgccacatacaggtatccacccggcattgtaggtgtggctccaggagggcttcct
ccagcgatggaagggatcatccctgggggcatccccgtgactcacaacctccccacagtg
gcacacccctcccaagctccttcccccaaccagcccacaaaacacggggacaatcgagag
caccccaacgagcaatag

DBGET integrated database retrieval system