KEGG   Mus musculus (mouse): 13063Help
Entry
13063             CDS       T01002                                 

Gene name
Cycs
Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05222  Small cell lung cancer
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    13063 (Cycs)
   04215 Apoptosis - multiple species
    13063 (Cycs)
   04115 p53 signaling pathway
    13063 (Cycs)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13063 (Cycs)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13063 (Cycs)
   05222 Small cell lung cancer
    13063 (Cycs)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13063 (Cycs)
   05012 Parkinson disease
    13063 (Cycs)
   05014 Amyotrophic lateral sclerosis (ALS)
    13063 (Cycs)
   05016 Huntington disease
    13063 (Cycs)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    13063 (Cycs)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    13063 (Cycs)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    13063 (Cycs)
   05152 Tuberculosis
    13063 (Cycs)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    13063 (Cycs)
   05162 Measles
    13063 (Cycs)
   05164 Influenza A
    13063 (Cycs)
   05161 Hepatitis B
    13063 (Cycs)
   05160 Hepatitis C
    13063 (Cycs)
   05168 Herpes simplex virus 1 infection
    13063 (Cycs)
   05163 Human cytomegalovirus infection
    13063 (Cycs)
   05167 Kaposi sarcoma-associated herpesvirus infection
    13063 (Cycs)
   05169 Epstein-Barr virus infection
    13063 (Cycs)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    13063 (Cycs)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    13063 (Cycs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Motif
Other DBs
NCBI-GeneID: 13063
NCBI-ProteinID: NP_031834
MGI: 88578
Ensembl: ENSMUSG00000063694
Vega: OTTMUSG00000034264
UniProt: P62897 Q56A15
LinkDB All DBs
Position
6 B2.3; 6 24.32 cM
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaagatttttgttcagaagtgtgcccagtgccacact
gtggaaaagggaggcaagcataagactggaccaaatctccacggtctgttcgggcggaag
acaggccaggctgctggattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggataccctgatggagtatttggagaatcccaaaaagtacatccctggaacaaaa
atgatcttcgctggaattaagaagaagggagaaagggcagacctaatagcttatcttaaa
aaggctactaatgagtaa

KEGG   Mus musculus (mouse): 13067Help
Entry
13067             CDS       T01002                                 

Gene name
Cyct, T-Cc
Definition
(RefSeq) cytochrome c, testis
  KO
K08738  cytochrome c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05222  Small cell lung cancer
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    13067 (Cyct)
   04215 Apoptosis - multiple species
    13067 (Cyct)
   04115 p53 signaling pathway
    13067 (Cyct)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13067 (Cyct)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13067 (Cyct)
   05222 Small cell lung cancer
    13067 (Cyct)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    13067 (Cyct)
   05012 Parkinson disease
    13067 (Cyct)
   05014 Amyotrophic lateral sclerosis (ALS)
    13067 (Cyct)
   05016 Huntington disease
    13067 (Cyct)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    13067 (Cyct)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    13067 (Cyct)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    13067 (Cyct)
   05152 Tuberculosis
    13067 (Cyct)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    13067 (Cyct)
   05162 Measles
    13067 (Cyct)
   05164 Influenza A
    13067 (Cyct)
   05161 Hepatitis B
    13067 (Cyct)
   05160 Hepatitis C
    13067 (Cyct)
   05168 Herpes simplex virus 1 infection
    13067 (Cyct)
   05163 Human cytomegalovirus infection
    13067 (Cyct)
   05167 Kaposi sarcoma-associated herpesvirus infection
    13067 (Cyct)
   05169 Epstein-Barr virus infection
    13067 (Cyct)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    13067 (Cyct)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    13067 (Cyct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Motif
Other DBs
NCBI-GeneID: 13067
NCBI-ProteinID: NP_034119
MGI: 88579
Ensembl: ENSMUSG00000056436
Vega: OTTMUSG00000013135
UniProt: P00015
LinkDB All DBs
Structure
PDB: 

Position
2 C3; 2 44.94 cM
AA seq 105 aa AA seqDB search
MGDAEAGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGVIW
SEETLMEYLENPKKYIPGTKMIFAGIKKKSEREDLIKYLKQATSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgctgaagcaggcaagaagatctttgttcagaaatgtgctcagtgccacacg
gtggaaaaaggcgggaaacacaagacaggtccaaatctctggggcctctttggtcgaaag
acaggacaagcaccaggattttcttacacggatgcaaacaagaacaaaggtgttatctgg
tcagaagaaactttgatggaatatttggagaacccgaagaaatatatccctggcactaaa
atgatctttgctggtatcaaaaagaagagtgagagagaagatctcattaagtatttaaaa
caggccacatcctcatga

DBGET integrated database retrieval system