KEGG   Mus musculus (mouse): 13143Help
Entry
13143             CDS       T01002                                 

Gene name
Dapk2
Definition
(RefSeq) death-associated protein kinase 2
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu05200  Pathways in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    13143 (Dapk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13143 (Dapk2)
  09162 Cancer: specific types
   05219 Bladder cancer
    13143 (Dapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13143 (Dapk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13143 (Dapk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   13143 (Dapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Kdo Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 13143
NCBI-ProteinID: NP_034149
MGI: 1341297
Ensembl: ENSMUSG00000032380
Vega: OTTMUSG00000029452
UniProt: Q8VDF3
LinkDB All DBs
Structure
PDB: 

Position
9 C; 9 35.75 cM
AA seq 370 aa AA seqDB search
MVQASMRSPNMETFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSR
ASRRGVCREEIEREVSILRQVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKES
LSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIED
GVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANIT
AVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITPVDTQQAMVRRESV
VNLENFKKQYVRRRWKLSFSIVSLCNHLTRSLMKKVHLRTSEDLRNCESDTEENIARRKA
LHPRRRSSTS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggtccaggcctcgatgaggagcccaaatatggagacgttcaaacagcagaaggtggag
gacttttatgatattggagaggagctgggcagtggccagtttgccatcgtgaagaagtgc
cgggagaagagcacggggctggagtatgcagccaagttcattaagaagaggcagagccgg
gccagccgtcggggcgtgtgccgggaggaaatcgagcgggaggtgagcatcctgcggcag
gtgctgcaccccaacatcatcacgctgcacgacgtctatgagaaccgcaccgacgtggtg
ctcatccttgagctagtgtccggaggagaactgtttgatttcctggcccagaaggagtcg
ttaagtgaggaggaagccaccagcttcattaagcagatcctggatggggtgaattacctt
cacacaaagaaaattgctcactttgatctcaagccagaaaacatcatgttgttagacaag
aatatcccaattccacacatcaagctgattgactttggcctggctcacgaaatagaagat
ggagttgaatttaaaaacatttttgggacacctgaatttgttgctccagaaatcgtgaac
tatgagccactgggactggaggccgacatgtggagcattggagtcatcacctatatcctt
ctaagtggagcgtcccccttcctgggagacacaaaacaagaaaccctggcaaatatcact
gctgtgagttacgactttgatgaggaattcttcagccagacaagcgagctggccaaggac
ttcattcggaagcttcttgtgaaagagacccggaaacggcttaccatccaagaggctctc
agacatccctggatcacgccggtggacacccagcaagctatggtacgcagagagtccgtg
gtcaacctggagaattttaagaagcagtatgtccgcaggcggtggaagctgtccttcagc
atcgtctccttgtgcaaccacctcactcgctccctgatgaagaaggtacatctgaggaca
agcgaggacctgaggaactgcgagagtgacacagaggagaacatcgccaggaggaaagcc
cttcacccccggaggaggagcagtacctcctaa

KEGG   Mus musculus (mouse): 13144Help
Entry
13144             CDS       T01002                                 

Gene name
Dapk3, ZIPK, dlk
Definition
(RefSeq) death-associated protein kinase 3
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu05200  Pathways in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    13144 (Dapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13144 (Dapk3)
  09162 Cancer: specific types
   05219 Bladder cancer
    13144 (Dapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13144 (Dapk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     13144 (Dapk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   13144 (Dapk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo RIO1 Choline_kinase DUF3847
Motif
Other DBs
NCBI-GeneID: 13144
NCBI-ProteinID: NP_001177402
MGI: 1203520
Ensembl: ENSMUSG00000034974
UniProt: O54784 Q05A21
LinkDB All DBs
Position
10 C1; 10 39.72 cM
AA seq 448 aa AA seqDB search
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREE
IEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKVRRREDGARKPERRRLRAARLREY
SLKSHSSMPRNTSYASFERFSRVLEDVAAAEQGLRELQRGRRQCRERVCALRAAAEQREA
RCRDGSAGLGRDLRRLRTELGRTEALRTRAQEEARAALLGAGGLKRRLCRLENRYDALAA
QVAAEVQFVRDLVRALEQERLQAECGVR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattcaggcaagaggatgttgaggaccattatgagatgggagaggagcttggc
agtggccaatttgccatcgtgcgcaagtgccagcagaagggcacgggcatggagtatgca
gccaagttcatcaagaagcggcgcctgccatccagccggcgcggtgtgagccgggaggag
atcgaacgcgaggtgagcatcctgcgcgagatccgccaccccaacatcataacactgcat
gacgtgttcgagaacaagacagatgtggtgctgatcctggagctggtgtccggtggcgag
cttttcgacttcctggccgagaaggagtcattgacggaggatgaggccacgcagttcctc
aaacaaatcctagacggtgtccactacctgcactccaagcgcatcgcacactttgacctg
aagcccgagaacatcatgttgctggacaagcacgcagccagcccccgcattaagctcatc
gactttggcatcgcgcacaggatcgaggctggcagcgagttcaagaacatctttggcaca
cccgagtttgtcgcccccgagatcgtgaactatgagccacttggcttggaggctgacatg
tggagcattggcgtcatcacctacatcctcctgagcggagcgtccccattcctgggcgag
accaagcaggagacgctgacgaacatctcagcagtgaactatgactttgatgaggaatac
ttcagcagcaccagcgagctggccaaggacttcatccgcaggctgctggtcaaagacccc
aagaggaggatgaccatcgcacagagcctggagcattcctggatcaaggtgcgcaggcgc
gaggacggcgcccggaagccagagcgacggcggctgcgcgccgcgcgcctgcgcgagtac
agcctcaagtcccactcgagcatgccgcgcaacacgagctacgccagcttcgagcgcttc
tcacgcgtgctggaggacgtggcggcggcagagcaggggctgcgcgagctgcagcgaggc
aggcgccagtgccgggagcgcgtgtgtgcgctgcgcgcggccgccgagcagcgggaggcg
cgctgccgcgacgggagcgcagggctagggcgcgacctgcgacgcctgcgcacggagctg
gggcgcaccgaggctctgcgcacgcgcgcgcaggaggaggcgcgggcggcgctgttgggt
gccgggggcctgaagcgtcgcctgtgtcgcctggagaaccgttacgacgcgctagccgct
caggtggccgctgaggtgcaattcgtgcgcgacctggtgcgtgcgctggagcaggaacgg
ctgcaggctgagtgcggcgtgcgctag

KEGG   Mus musculus (mouse): 69635Help
Entry
69635             CDS       T01002                                 

Gene name
Dapk1, D13Ucla1, DAP-Kinase
Definition
(RefSeq) death associated protein kinase 1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
mmu05200  Pathways in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    69635 (Dapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    69635 (Dapk1)
  09162 Cancer: specific types
   05219 Bladder cancer
    69635 (Dapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    69635 (Dapk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     69635 (Dapk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   69635 (Dapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank Pkinase_Tyr Ank_3 Death COR Kdo RIO1 O_Spanin_T7 AAA_29 APH ABC_tran AAA_23 Choline_kinase DUF3847 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 69635
NCBI-ProteinID: NP_001272846
MGI: 1916885
Ensembl: ENSMUSG00000021559
UniProt: Q80YE7 Q3UKP8
LinkDB All DBs
Position
13 B2; 13 32.53 cM
AA seq 1442 aa AA seqDB search
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIRHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILSGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYDFEEEF
FRNTSTLAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSSYDVNQPNKHGTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPDFQDKEEET
PLHCAAWHGYYSVAKALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAS
DKDGHIALHLAVRRCQMEVIKTLLGHGSFVDFQDRHGNTPLHVACKDGSAPIVVALCEAS
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVEALTSDGKTAEDLAKAEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLAAKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
SHHLHCSTDDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNIPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQIVSGCS
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEDDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVSGCRIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIETVMATTLPGLLTVKHYLSPQQLREHHEPVMVYQPRDFFRA
QTLKESSLTNTMGGYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDMVAKHNVNNRASRDFLPSPVHALLQEWTSYPESTVGILISKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSRRDSHAWTPLY
DL
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgttcaggcaggaaaacgtggacgactactacgacaccggcgaggaactgggc
agtggacagttcgcagttgtgaagaaatgtcgtgagaaaagtaccggtcttcagtatgcg
gccaagttcatcaagaaaaggaggaccaagtccagccggcggggcgtgagccgggaggac
atcgagcgggaggtcagcatcctgaaggagatccggcacccaaatgtcatcaccctgcat
gaggtctatgagaacaagacagatgtcattctgatcctggagcttgttgcaggaggtgag
ctgtttgacttcctggctgagaaggaatctctgactgaagaggaggcaacggaattcctt
aagcagattctcagcggcgtttactacctgcactcactgcagatcgctcactttgacctg
aagccggaaaacataatgcttctggatagaaatgtgcccaaacctcggatcaagatcata
gactttggcttggcccataaaattgactttggaaatgaattcaaaaacatatttgggaca
ccagagtttgtggctccggagatagtcaactatgagcccctgggtcttgaggcagatatg
tggagcatcggggtaataacctatatcctcctaagtggggcctccccttttcttggagac
accaagcaagaaacattagcgaatgtgtccgctgtcaactacgactttgaggaggaattc
ttccggaacaccagtacccttgccaaagatttcatcagaagactgctggtcaaggatcca
aagaagaggatgacaatccaggacagtttgcagcacccctggatcaagcctaaagacacc
caacaagcacttagtcgaaaagcctcagcagtaaacatggagaaattcaagaagtttgca
gctcggaaaaaatggaaacaatctgttcgcttgatatcactgtgccaaagattatccagg
tcatttttgtccagaagtaacatgagtgtcgccaggagtgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcatccatgccatcaatgatgacaacgtacccggcctg
cagcatctcctgggctccttgtccagctatgacgtcaaccagcccaacaagcatgggaca
cctccattactgattgccgcaggctgtggcaacatccagatgttacagttactcataaaa
cgaggctcaaggattgacgtccaggataagggaggatccaatgccatctactgggcctct
cggcatggccatgtggatactttgaaatttctcaatgagaacaaatgccctttggatgtt
aaagacaagtctggagagacagctcttcacgtggcagcccgctatggccatgcagatgtg
gttcaactactgtgcagttttggctctaatcctgatttccaggacaaggaagaggaaacc
cccctgcactgtgctgcctggcatggctattactccgtggctaaagctctttgtgaagtt
ggctgcaacgtgaatatcaagaatcgggagggagagaccccattgctgacggcgtctgcc
aggggctatcatgacattgtggagtgtctggctgaacatggagctgacttgaatgcttct
gacaaggatggacacatcgctcttcatcttgctgtgaggcgttgtcagatggaagtcatc
aagaccctccttggccatgggtcctttgtggatttccaggacaggcatggcaacacaccc
ctgcacgtggcctgcaaagatggaagcgcacctatcgtggtggccctctgtgaagccagc
tgcaatctggacatctcaaacaagtatggtcggactcctctccaccttgcagccaacaac
gggatcctagatgtggtccgctacctctgtttgatgggcgccaatgtggaggctctaacc
tcggatggaaagacggccgaggacctcgccaaggcagaacagcacgagcatgtggcaggg
ctcctggcaagactgcggaaggacacacaccgaggactcttcatccagcaactccgaccc
acccagaatctccagcccagaatcaagctcaaactgtttggccattcgggatcagggaaa
tccaccctggtggaatctctcaagtgtgggctgttaaggagtttcttcagaaggcgccgg
cccagactatcctctaccaactccacccgcttcccaccgtcacccctggctgctaagcca
acagtctcagtgagcattaacaacctgtaccccggctgtgagaacgtgagcgtaaggagc
cgcagcatgatgttcgagccgggcctcaccaaagggatgctggaagtgttcgtggctccg
tctcaccacctccactgctcgactgatgaccagtccaccaaagccatcgacatccagaat
gcttatttgaacggagttggtgatttcagtgtgtgggagttctctggaaaccctgtgtac
ttctgttgctatgactactttgctgccaacgaccccacgtccatccacatcatcgttttc
agtctcgaagaaccctatgagatccagctgaaccaagtgattttctggctcagtttcctg
aagtctctggtcccagttgaagaacccatagcatttggaggcaagctgaagaaccctctc
cgagttgtcctggtggcaacacatgctgacatcatgaacatccctcggcctgctggaggc
gagtttggatatgacaaggatacatccttgctgaaagagatcagaaacaggttcgggaat
gaccttcatgtctcaaacaagctgtttgtcctggatgcaggagcgtctgggtctaaggac
attaaggttcttcggaatcacctgcaagaaatacggagccagattgtctcggggtgttcg
cccatgactcacctgtgcgagaagatcatctccacgctgccctcctggcggaagctcaac
gggccaaaccagctgatgtcgctgcagcagtttgtgtatgacgtgcaggaccagctgaac
cccctggcctctgaggatgacctcaggcgcattgcacaacagctacacagcacgggcgag
ataaacatcatgcagagtgagacagtgcaggacgtgttactgctggatcctcgatggctc
tgcaccaacgtcctggggaagctgctgtctgtggagacgccccgagccctgcaccattac
cggggccgctacaccatggaagacatccagcgtctggtcccagacagtgacgtggaggag
ctgctgcagatactggatgccatggacatctgcgcccgagacctgagtagtgggactatg
gtggatatccctgctctgatcaaaacagacagcctgcagcgctcctgggcggatgaggag
gatgaggtgatggtgtacggtggggtgcgcattgtccctgtagagcacctcacccccttc
ccctgtggcatctttcacaaagttcaggtcaacctgtgccgatggatccaccagcaaagc
gcggagggtgatgcggacatccgtctgtgggtgagcggctgcaggatcgccaaccgcggg
gctgagttgctggtgctgctggtcaatcacggtcagggcatcgaggtacaggtgcgtggc
ctggagacggagaagattaagtgctgcctgctgctggactcggtgtgcagcaccatcgag
accgtcatggccaccaccttgccagggttgttgacggtgaagcactacctgagcccccag
cagctaagggagcaccacgaaccggtcatggtctatcagccccgggacttcttccgtgcg
cagaccctgaaagagagttcccttaccaacaccatgggtgggtacaaggagagcttcagc
agcatcacgtgctttgggtgtcatgacgtctactcacaggccagtcttggcatggatatc
catgcgtcagacctgagtctcctgacccggaggaaactgagtcgcctgcttgacccaccc
gaccccatggggaaggactggtgccttctggccatgaacttgggcctcccagacatggtg
gccaaacacaacgtcaacaacagggcttctagggatttcctccctagcccagtgcatgcc
ttgctacaggaatggacctcctaccctgagagcacggtgggcatccttatatccaaactt
cgggagctggggcgccgggatgctgcggactttttactgaaggcctcctctgtgttcaag
atcaaccttgatggcaatggccaggaggcctatgcctcaagctgtaacagtggcacgtcc
tacaattccattagctcagtggtgtcccggagagactcccatgcttggaccccactgtat
gatttataa

DBGET integrated database retrieval system