KEGG   Mus musculus (mouse): 13176Help
Entry
13176             CDS       T01002                                 

Gene name
Dcc, C030036D22Rik, Igdcc1
Definition
(RefSeq) deleted in colorectal carcinoma
  KO
K06765  deleted in colorectal carcinoma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13176 (Dcc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13176 (Dcc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13176 (Dcc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 Ig_4 Interfer-bind Ig_6 CD34_antigen EphA2_TM V-set_CD47 FAM176 Ly49 DUF4998 Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 13176
NCBI-ProteinID: NP_031857
MGI: 94869
Ensembl: ENSMUSG00000060534
Vega: OTTMUSG00000021996
UniProt: P70211 Q3TZP5
LinkDB All DBs
Structure
PDB: 

Position
18 E2; 18 45.24 cM
AA seq 1447 aa AA seqDB search
MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKPFTSLHFVSEPSDAVTMRGGNVLLN
CSAESDRGVPVIKWKKDGLILALGMDDRKQQLPNGSLLIQNILHSRHHKPDEGLYQCEAS
LADSGSIISRTAKVTVAGPLRFLSQTESITAFMGDTVLLKCEVIGEPMPTIHWQKNQQDL
NPLPGDSRVVVLPSGALQISRLQPGDSGVYRCSARNPASIRTGNEAEVRILSDPGLHRQL
YFLQRPSNVIAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGTYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQSSAQLIVPKP
AIPSSSILPSAPRDVLPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLHAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYTLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNISLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSGPDV
STPMLPPVGVQAVALTHEAVRVSWADNSVPKNQKTSDVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLSLDTMYYF
RIQARNVKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVITVVTVGVLTVLVVVIVAVICTRRSSAQQRKKRATHSVSK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPTGTDPAGRDSPIQSCQDLTPVSHSQSETQMGS
KSASHSGQDTEDAGSSMSTLERSLAARRATRAKLMIPMEAQSSNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRTQSVSEGPTTQQQPMLPPAQPEH
PSSEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVK
TASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDPASVYEQDDLSEQMASLEGLMKQLN
AITGSAF
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtcttggatgtgtttgggtacccaagctggcttttgtactcttcggagct
tccttgctcagcgcacatcttcaagtcacgggtttccaaattaaacctttcacgtcactt
cattttgtgtctgaaccttcggatgctgtcaccatgcggggaggaaatgtcctgctcaac
tgctctgcagagtccgaccgaggagttccagtcatcaagtggaagaaagacggccttatc
ctagccttgggcatggatgacagaaagcagcaacttcctaatggatctctgttgatacaa
aacatacttcattccagacaccataagccggatgaaggactttaccaatgcgaggcatcc
ttagcagattctggctcaattattagtcggacagcaaaagttacggtagcagggccattg
aggttcctttcccagacggaatctatcacagccttcatgggagatacagtgttacttaag
tgtgaagtcattggggaacccatgccaacaatacactggcagaaaaatcaacaagacctc
aacccactcccaggagactcgcgtgtggtcgtcttgccctccggagcattgcagattagc
cgacttcagccaggagacagtggagtctacagatgctcggctcggaatccagccagcata
agaacaggaaatgaagcagaagttagaattttatcagacccaggcctgcataggcagcta
tattttctgcagagaccatccaacgtaatagccattgaagggaaagatgctgtcctggag
tgctgtgtttctggctatcctccgccaagtttcacctggttacgaggcgaggaggtcatc
caactcaggtctaaaaagtattcattgttgggtggaagcaatttgctcatctctaatgtg
acagatgatgacagtggaacctatacttgcgttgtcacctataagaatgagaatattagt
gcctctgcagagctcacggtcttggttccgccctggtttttaaatcacccttccaacctc
tatgcctatgagagcatggatattgagtttgaatgtgcagtttctgggaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtgatcccgagtgactattttcagatagtg
ggaggaagcaacttacggatccttggggtggtcaagtcagatgaaggcttctatcaatgt
gtggctgaaaatgaggctggcaatgcccaaagtagtgcccagctgattgtccccaagcct
gccatcccaagctccagcatcctcccttctgctcccagagatgtgctccctgtcttggtt
tctagtcgctttgtccgtttgagctggcgtccacctgcagaagcaaaagggaacattcaa
accttcacagtctttttctccagagagggtgacaacagggagcgagctttgaatacaacc
cagcctgggtcccttcagcttactgtgggaaacttgaaaccagaagccatgtacaccttc
agagttgtcgcctacaatgagtggggaccaggggagagttctcagcccatcaaggtggcc
actcagcctgagttgcaagttccagggccagtagaaaacctgcatgctgtatctacctca
cctacctcaattcttattacatgggaaccccctgcctatgcaaatggcccagtccaaggt
tacagattgttctgcactgaggtgtctacaggaaaagaacagaatatagaggttgatgga
ctatcttataaactggaaggcctgaaaaaattcacggaatatactcttcgattcctagct
tataatcgttatgggccaggagtatctactgatgatataacagttgttacactttcagac
gtgccaagtgctccacctcagaacatctcactggaagtggttaactcaaggagtatcaaa
gtaagctggctccctcctccatcgggaacacaaaatggatttattactggctataaaatt
cgacacagaaagactacccgcaggggcgagatggaaacactggaaccgaataacctctgg
tacctcttcacaggattggagaaaggcagtcagtacagtttccaagtgtcggccatgaca
gtcaatggtactggaccaccttccaactggtacacagcggagaccccagagaatgattta
gatgagtctcaagtccctgaccagccgagttctcttcacgtgaggccccagacaaactgt
atcatcatgagttggacacctcctctcaacccaaacatcgtggtgagaggctatattatt
ggctatggtgttggcagtccttatgctgaaacagtgcgtgtggacagtaagcagcggtac
tattccatcgagagactagagtcgagttctcattatgtaatctccttaaaagctttcaac
aatgccggagaaggtgtccctctctacgaaagtgccaccactcgttccataacagatccc
actgaccccgttgattattatcctttgcttgatgatttccccacctcgggcccagatgtc
tccacccccatgctcccaccagtaggtgtacaggctgtggctcttacccatgaggctgtg
agggtcagctgggcagacaactctgtcccgaagaaccagaaaacatccgatgtgcgactg
tacaccgttcggtggaggaccagcttttctgccagtgccaagtacaagtcagaagacaca
acatctctcagttacacagcgactggcctcaagcccaataccatgtacgagttctcagtc
atggtgaccaagaacagaaggtcaagcacgtggagcatgactgcacacgccaccacctac
gaagctgccccaacttctgctcccaaggatctgacagtcattactcgagaggggaagcct
cgtgctgtcattgtgagctggcagcctcccttggaagccaatgggaaaatcactgcttat
atcttgttttatacattggacaagaatataccaatagatgattggattatggaaactatc
agcggtgaccggcttacccatcagatcatggatctcagccttgacacgatgtattacttt
cgaattcaagcacggaatgtgaaaggagtagggcccctctctgatcccatcctcttcagg
actttgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatggg
ggttattggccagttgatactaacttgattgatagaagcactctcaacgaaccacccatt
ggacagatgcaccccccgcatggcagtgtcactcctcagaagaacagcaacctgcttgta
ataaccgtggtcaccgttggtgttctcactgtgttggtcgtggtgattgtagcagtgatt
tgcacccggcgttcttcagcgcagcagaggaagaaacgggccacacacagtgtgagcaag
aggaagggcagtcagaaggacctccggcctcccgatctttggatacatcatgaagaaatg
gaaatgaaaaatatcgagaagcctacgggaaccgaccctgcaggaagagactcccccatc
cagagctgccaagatctcacaccagtcagccatagccagtcagaaacccagatgggaagc
aaaagtgcctctcattcaggtcaggacactgaggacgcaggcagctccatgtccactttg
gaacggtccctggcagcacgccgggccaccagggccaagctcatgattcccatggaggcc
cagtccagtaatcctgctgttgtgagtgccatccctgtaccaacactagaaagtgcccag
tatccaggaatcctcccatctcccacatgtggatacccgcatccacagttcactctccgg
ccagtaccattcccaacgctgtctgtggaccgaggttttggagcaggaagaactcagtct
gtgagtgaaggaccaaccacgcaacagcaacccatgctgcccccagctcagcccgaacat
ccgagcagtgaagaagcacccagtagaaccatccccacagcctgtgtgcggccaactcat
ccactccgcagctttgctaacccattactacctccacccatgagtgcaatagaaccaaaa
gtcccttacacaccgcttttgtctcagccaggacccacccttcccaagactcatgttaaa
acggcctcccttgggctggccggaaaggcaaggtcccctttgcttcccgtgtctgtgcca
acagcccctgaagtgtctgaggagagccacaagcccacagaggatccagccagtgtatat
gaacaggatgacttgagcgaacaaatggcaagtttggaagggctaatgaagcaactcaac
gccatcacagggtctgccttttga

DBGET integrated database retrieval system