KEGG   Mus musculus (mouse): 13197Help
Entry
13197             CDS       T01002                                 

Gene name
Gadd45a, AA545191, Ddit1, GADD45
Definition
(RefSeq) growth arrest and DNA-damage-inducible 45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13197 (Gadd45a)
   04068 FoxO signaling pathway
    13197 (Gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    13197 (Gadd45a)
   04210 Apoptosis
    13197 (Gadd45a)
   04115 p53 signaling pathway
    13197 (Gadd45a)
   04218 Cellular senescence
    13197 (Gadd45a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13197 (Gadd45a)
   05202 Transcriptional misregulation in cancer
    13197 (Gadd45a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13197 (Gadd45a)
   05212 Pancreatic cancer
    13197 (Gadd45a)
   05225 Hepatocellular carcinoma
    13197 (Gadd45a)
   05226 Gastric cancer
    13197 (Gadd45a)
   05214 Glioma
    13197 (Gadd45a)
   05216 Thyroid cancer
    13197 (Gadd45a)
   05220 Chronic myeloid leukemia
    13197 (Gadd45a)
   05217 Basal cell carcinoma
    13197 (Gadd45a)
   05218 Melanoma
    13197 (Gadd45a)
   05213 Endometrial cancer
    13197 (Gadd45a)
   05224 Breast cancer
    13197 (Gadd45a)
   05222 Small cell lung cancer
    13197 (Gadd45a)
   05223 Non-small cell lung cancer
    13197 (Gadd45a)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    13197 (Gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    13197 (Gadd45a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     13197 (Gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     13197 (Gadd45a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae XPA_C
Motif
Other DBs
NCBI-GeneID: 13197
NCBI-ProteinID: NP_031862
MGI: 107799
Ensembl: ENSMUSG00000036390
Vega: OTTMUSG00000023157
UniProt: P48316 Q3UMH6
LinkDB All DBs
Position
6; 6 C1
AA seq 165 aa AA seqDB search
MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaggaattctcggctgcagagcagaagaccgaaaggatggacacggtgggc
gatgccctggaggaagtgctcagcaaggctcggagtcagcgcaccattacggtcggcgtg
tacgaggctgccaagctgctcaacgtagaccccgataacgtggtactgtgcctgctggct
gctgacgaagacgacgaccgggatgtggctctgcagatccatttcaccctcatccgtgcg
ttctgctgcgagaacgacatcaacatcctgcgggtcagcaacccgggtcggctagctgag
ctgctgctactggagaacgacgcgggcccggcggagagcgggggcgccgcgcagaccccg
gacctgcactgtgtgctggtgacgaacccacattcatcacaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggtgcccgtgatt
aatctcccggaacggtga

KEGG   Mus musculus (mouse): 17873Help
Entry
17873             CDS       T01002                                 

Gene name
Gadd45b, AI323528, Myd118
Definition
(RefSeq) growth arrest and DNA-damage-inducible 45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17873 (Gadd45b)
   04064 NF-kappa B signaling pathway
    17873 (Gadd45b)
   04068 FoxO signaling pathway
    17873 (Gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17873 (Gadd45b)
   04210 Apoptosis
    17873 (Gadd45b)
   04115 p53 signaling pathway
    17873 (Gadd45b)
   04218 Cellular senescence
    17873 (Gadd45b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17873 (Gadd45b)
   05202 Transcriptional misregulation in cancer
    17873 (Gadd45b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17873 (Gadd45b)
   05212 Pancreatic cancer
    17873 (Gadd45b)
   05225 Hepatocellular carcinoma
    17873 (Gadd45b)
   05226 Gastric cancer
    17873 (Gadd45b)
   05214 Glioma
    17873 (Gadd45b)
   05216 Thyroid cancer
    17873 (Gadd45b)
   05220 Chronic myeloid leukemia
    17873 (Gadd45b)
   05217 Basal cell carcinoma
    17873 (Gadd45b)
   05218 Melanoma
    17873 (Gadd45b)
   05213 Endometrial cancer
    17873 (Gadd45b)
   05224 Breast cancer
    17873 (Gadd45b)
   05222 Small cell lung cancer
    17873 (Gadd45b)
   05223 Non-small cell lung cancer
    17873 (Gadd45b)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    17873 (Gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    17873 (Gadd45b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     17873 (Gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     17873 (Gadd45b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 17873
NCBI-ProteinID: NP_032681
MGI: 107776
Ensembl: ENSMUSG00000015312
UniProt: P22339
LinkDB All DBs
Position
10 C1; 10 39.72 cM
AA seq 160 aa AA seqDB search
MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCL
LVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggaagagctggtggcgagcgacaacgcggttcagaagatgcaggcggtgact
gccgcggtggagcagctgctggtggccgcgcagcgtcaggatcgcctcaccgtgggggtg
tacgaggcggccaaactgatgaatgtggaccccgacagcgtggtcttgtgcctcctggcc
atagacgaagaagaggaggatgatatcgctctgcagattcacttcaccctgatccagtcg
ttctgctgcgacaatgacattgacatcgtccgggtatcaggcatgcagaggctggcgcag
ctcctgggggagccggcggagacattgggcacaaccgaagcccgagacctgcactgcctc
ctggtcacgaactgtcatacagattcctggaaaagccaaggcttggtggaggtggccagt
tactgtgaagagagcagaggcaataaccaatgggtcccctatatctctctagaggaacgc
tga

KEGG   Mus musculus (mouse): 23882Help
Entry
23882             CDS       T01002                                 

Gene name
Gadd45g, AI327420, C86281, CR6, DDIT2, OIG37
Definition
(RefSeq) growth arrest and DNA-damage-inducible 45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23882 (Gadd45g)
   04068 FoxO signaling pathway
    23882 (Gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    23882 (Gadd45g)
   04210 Apoptosis
    23882 (Gadd45g)
   04115 p53 signaling pathway
    23882 (Gadd45g)
   04218 Cellular senescence
    23882 (Gadd45g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23882 (Gadd45g)
   05202 Transcriptional misregulation in cancer
    23882 (Gadd45g)
  09162 Cancer: specific types
   05210 Colorectal cancer
    23882 (Gadd45g)
   05212 Pancreatic cancer
    23882 (Gadd45g)
   05225 Hepatocellular carcinoma
    23882 (Gadd45g)
   05226 Gastric cancer
    23882 (Gadd45g)
   05214 Glioma
    23882 (Gadd45g)
   05216 Thyroid cancer
    23882 (Gadd45g)
   05220 Chronic myeloid leukemia
    23882 (Gadd45g)
   05217 Basal cell carcinoma
    23882 (Gadd45g)
   05218 Melanoma
    23882 (Gadd45g)
   05213 Endometrial cancer
    23882 (Gadd45g)
   05224 Breast cancer
    23882 (Gadd45g)
   05222 Small cell lung cancer
    23882 (Gadd45g)
   05223 Non-small cell lung cancer
    23882 (Gadd45g)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    23882 (Gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    23882 (Gadd45g)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     23882 (Gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     23882 (Gadd45g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 23882
NCBI-ProteinID: NP_035947
MGI: 1346325
Ensembl: ENSMUSG00000021453
Vega: OTTMUSG00000023076
UniProt: Q9R0S0
LinkDB All DBs
Structure
PDB: 

Position
13; 13 A5
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADEEGGAPGDLHCI
LISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagtccgtggccaggatacagttccggaaagcacagccaggatgcag
ggcgccgggaaagcactgcacgaacttctgctgtcggcgcagcgccagggctgtctgacc
gctggcgtctacgagtccgccaaagtcctgaatgtggaccctgacaatgtgaccttttgc
gtgctggctgccgatgaagaagatgagggcgacatagcgctgcagatccatttcacgttg
attcaggcgttctgctgtgagaacgacattgatatcgtgcgcgtgggagacgtgcagagg
ctggcggcgatcgtgggcgccgacgaagaggggggcgcgccgggagacctgcattgcatc
ctcatttcgaatcctaatgaggacacatggaaggaccctgccttggagaagctcagtttg
ttctgcgaggagagccgcagcttcaacgactgggtgcccagcatcacccttcccgagtga

DBGET integrated database retrieval system