KEGG   Mus musculus (mouse): 13388Help
Entry
13388             CDS       T01002                                 

Gene name
Dll1, Delta1
Definition
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    13388 (Dll1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    13388 (Dll1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13388 (Dll1)
  09162 Cancer: specific types
   05224 Breast cancer
    13388 (Dll1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    13388 (Dll1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF MNNL DSL EGF_CA EGF_3 EGF_2 ECSCR
Motif
Other DBs
NCBI-GeneID: 13388
NCBI-ProteinID: NP_031891
MGI: 104659
Ensembl: ENSMUSG00000014773
Vega: OTTMUSG00000021037
UniProt: Q61483
LinkDB All DBs
Position
17 A2; 17 8.95 cM
AA seq 722 aa AA seqDB search
MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFR
VCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFS
LIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDE
HYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPG
ECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNG
ATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDSFSCTCPPGFYGK
VCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKCV
DLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAP
VSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLPEPPPGPMVVDLSERHMESQG
GPFPWVAVCAGVVLVLLLLLGCAAVVVCVRLKLQKHQPPPEPCGGETETMNNLANCQREK
DVSVSIIGATQIKNTNKKADFHGDHGAEKSSFKVRYPTVDYNLVRDLKGDEATVRDTHSK
RDTKCQSQSSAGEEKIAPTLRGGEIPDRKRPESVYSTSKDTKYQSVYVLSAEKDECVIAT
EV
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtcggagcgcgctagcccttgccgtggtctctgccctgctgtgccaggtctgg
agctccggcgtatttgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggctctggcccgccttgcgcctgcaggaccttctttcgc
gtatgcctcaagcactaccaggccagcgtgtcaccggagccaccctgcacctacggcagt
gctgtcacgccagtgctgggtgtcgactccttcagcctgcctgatggcgcaggcatcgac
cccgccttcagcaaccccatccgattccccttcggcttcacctggccaggtaccttctct
ctgatcattgaagccctccatacagactctcccgatgacctcgcaacagaaaacccagaa
agactcatcagccgcctgaccacacagaggcacctcactgtgggagaagaatggtctcag
gaccttcacagtagcggccgcacagacctccggtactcttaccggtttgtgtgtgacgag
cactactacggagaaggttgctctgtgttctgccgacctcgggatgacgcctttggccac
ttcacctgcggggacagaggggagaagatgtgcgaccctggctggaaaggccagtactgc
actgacccaatctgtctgccagggtgtgatgaccaacatggatactgtgacaaaccaggg
gagtgcaagtgcagagttggctggcagggccgctactgcgatgagtgcatccgataccca
ggttgtctccatggcacctgccagcaaccctggcagtgtaactgccaggaaggctggggg
ggccttttctgcaaccaagacctgaactactgtactcaccataagccgtgcaggaatgga
gccacctgcaccaacacgggccaggggagctacacatgttcctgccgacctgggtataca
ggtgccaactgtgagctggaagtagatgagtgtgctcctagcccctgcaagaacggagcg
agctgcacggaccttgaggacagcttctcttgcacctgccctcccggcttctatggcaag
gtctgtgagctgagcgccatgacctgtgcagatggcccttgcttcaatggaggacgatgt
tcagataaccctgacggaggctacacctgccattgccccttgggcttctctggcttcaac
tgtgagaagaagatggatctctgcggctcttccccttgttctaacggtgccaagtgtgtg
gacctcggcaactcttacctgtgccggtgccaggctggcttctccgggaggtactgcgag
gacaatgtggatgactgtgcctcctccccgtgtgcaaatgggggcacctgccgggacagt
gtgaacgacttctcctgtacctgcccacctggctacacgggcaagaactgcagcgcccct
gtcagcaggtgtgagcatgcaccctgccataatggggccacctgccaccagaggggccag
cgctacatgtgtgagtgcgcccagggctatggcggccccaactgccagtttctgctccct
gagccaccaccagggcccatggtggtggacctcagtgagaggcatatggagagccagggc
gggcccttcccctgggtggccgtgtgtgccggggtggtgcttgtcctcctgctgctgctg
ggctgtgctgctgtggtggtctgcgtccggctgaagctacagaaacaccagcctccacct
gaaccctgtgggggagagacagaaaccatgaacaacctagccaattgccagcgcgagaag
gacgtttctgttagcatcattggggctacccagatcaagaacaccaacaagaaggcggac
tttcacggggaccatggagccgagaagagcagctttaaggtccgataccccactgtggac
tataacctcgttcgagacctcaagggagatgaagccacggtcagggatacacacagcaaa
cgtgacaccaagtgccagtcacagagctctgcaggagaagagaagatcgccccaacactt
aggggtggggagattcctgacagaaaaaggccagagtctgtctactctacttcaaaggac
accaagtaccagtcggtgtatgttctgtctgcagaaaaggatgagtgtgttatagcgact
gaggtgtaa

KEGG   Mus musculus (mouse): 13389Help
Entry
13389             CDS       T01002                                 

Gene name
Dll3, pu, pudgy
Definition
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    13389 (Dll3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    13389 (Dll3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13389 (Dll3)
  09162 Cancer: specific types
   05224 Breast cancer
    13389 (Dll3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    13389 (Dll3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_2 DSL EGF_CA
Motif
Other DBs
NCBI-GeneID: 13389
NCBI-ProteinID: NP_031892
MGI: 1096877
Ensembl: ENSMUSG00000003436
Vega: OTTMUSG00000022517
UniProt: O88516 Q3UND5
LinkDB All DBs
Position
7 A3; 7 16.67 cM
AA seq 585 aa AA seqDB search
MVSLQVSPLSQTLILAFLLPQALPAGVFELQIHSFGPGPGLGTPRSPCNARGPCRLFFRV
CLKPGVSQEATESLCALGAALSTSVPVYTEHPGESAAALPLPDGLVRVPFRDAWPGTFSL
VIETWREQLGEHAGGPAWNLLARVVGRRRLAAGGPWARDVQRTGTWELHFSYRARCEPPA
VGAACARLCRSRSAPSRCGPGLRPCTPFPDECEAPSVCRPGCSPEHGYCEEPDECRCLEG
WTGPLCTVPVSTSSCLNSRVPGPASTGCLLPGPGPCDGNPCANGGSCSETSGSFECACPR
GFYGLRCEVSGVTCADGPCFNGGLCVGGEDPDSAYVCHCPPGFQGSNCEKRVDRCSLQPC
QNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGSRRCSCALGFG
GRDCRERADPCASRPCAHGGRCYAHFSGLVCACAPGYMGVRCEFAVRPDGADAVPAAPRG
LRQADPQRFLLPPALGLLVAAGLAGAALLVIHVRRRGPGQDTGTRLLSGTREPSVHTLPD
ALNNLRLQDGAGDGPSSSADWNHPEDGDSRSIYVIPAPSIYAREA
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtctctctgcaggtgtctccgctttcccagacgctgatcctggcttttcttcttcct
caggcactgccagctggtgtcttcgagctacaaattcattctttcgggccaggcccaggc
ctcgggaccccacgctccccctgcaacgcccgaggcccttgccgcctcttcttcagggtc
tgcctgaagcccggagtctcccaggaggccaccgagtccctgtgcgccctgggcgcagca
ctgagcacgagcgtcccggtctatacggagcaccccggagagtcagcggctgccctgccg
ctgcctgatggcctcgtacgtgtgcccttccgcgatgcttggccgggcaccttctccctc
gtcattgaaacctggagagagcagctgggagagcatgctggagggcccgcctggaacctg
ctagcacgtgtggtcggccgtagacgcctggcggctgggggcccgtgggcccgcgatgtg
cagcgcacaggcacatgggagttgcacttctcctaccgcgcgcggtgcgagccgcccgcc
gtcggggccgcctgcgcgcgcctgtgccgctcacgcagtgccccctcgcggtgtggcccg
ggactgcgaccctgcacgccattcccagacgagtgcgaagccccgtctgtgtgtcgacca
ggctgcagccccgagcacggctactgtgaagagcctgatgaatgccgttgcctggagggc
tggactggacccctctgcacggtccctgtctccaccagtagctgcctgaactccagggtt
cctggtcctgccagcactggatgccttttacctgggcctggaccttgtgatgggaaccca
tgtgccaatgggggcagctgtagtgaaacctctggctcctttgaatgtgcctgtccccgg
ggattctacgggcttcgatgtgaggtgagcggggtcacgtgcgcagatggaccctgcttc
aatggcggcttgtgtgttggcggtgaagatcctgactctgcctatgtctgtcattgccca
cctggtttccaaggctctaactgtgagaagagggtggaccgctgtagcctgcagccatgt
cagaatggcggcctctgcctggacctgggccacgcgttgcgctgccgctgtcgcgcggga
ttcgccgggccgcgctgcgagcacgacctggacgactgcgccggccgcgcctgtgccaac
ggcggcacgtgcgtggagggcggcggctcgcgccgctgctcctgtgcgctgggcttcggc
gggcgcgactgccgagaacgcgccgacccctgcgcctcccgcccctgcgcgcatggaggc
cgttgctacgcccacttctctggcctggtctgcgcctgcgcgcccggctacatgggcgtg
agatgcgagttcgctgtgcgcccggacggcgcggacgcggtgcccgccgccccgcggggc
ctgaggcaggcggatccacagcgctttcttctgcctcccgccttggggctgctggtggcc
gccggtttggctggcgccgcactcttggtcatccacgttcgccgccgaggtcctggccag
gataccgggactcgcctgctttctgggacccgggagccttcggtccacacgctcccggat
gcactcaacaacctgaggttacaagacggtgctggggatggccccagttcgtcggctgac
tggaatcatcctgaagatggagactctagatccatttatgtcataccagccccttccatt
tatgcacgagaggcctga

KEGG   Mus musculus (mouse): 54485Help
Entry
54485             CDS       T01002                                 

Gene name
Dll4, Delta4
Definition
(RefSeq) delta like canonical Notch ligand 4
  KO
K06051  delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    54485 (Dll4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    54485 (Dll4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54485 (Dll4)
  09162 Cancer: specific types
   05224 Breast cancer
    54485 (Dll4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    54485 (Dll4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 TMEM154 Ly49 Phage_holin_3_6 LYRIC
Motif
Other DBs
NCBI-GeneID: 54485
NCBI-ProteinID: NP_062327
MGI: 1859388
Ensembl: ENSMUSG00000027314
Vega: OTTMUSG00000015953
UniProt: Q9JI71
LinkDB All DBs
Position
2; 2 E5
AA seq 686 aa AA seqDB search
MTPASRSACRWALLLLAVLWPQQRAAGSGIFQLRLQEFVNQRGMLANGQSCEPGCRTFFR
ICLKHFQATFSEGPCTFGNVSTPVLGTNSFVVRDKNSGSGRNPLQLPFNFTWPGTFSLNI
QAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKIWRTDEQNDTLTRLSYSYRVICSDNY
YGESCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDEC
ICRPGWQGRLCNECIPHNGCRHGTCSIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGST
CSNSGPKGYTCTCLPGYTGEHCELGLSKCASNPCRNGGSCKDQENSYHCLCPPGYYGQHC
EHSTLTCADSPCFNGGSCRERNQGSSYACECPPNFTGSNCEKKVDRCTSNPCANGGQCQN
RGPSRTCRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGPVCTCPAGFSGRRCEVRI
THDACASGPCFNGATCYTGLSPNNFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLV
VLLVLLVMVVVAVRQLRLRRPDDESREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCG
LDKSNCGKLQNHTLDYNLAPGLLGRGGMPGKYPHSDKSLGEKVPLRLHSEKPECRISAIC
SPRDSMYQSVCLISEERNECVIATEV
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgcgtcccggagcgcctgtcgctgggcgctactgctgctggcggtactgtgg
ccgcagcagcgcgctgcgggctccggcatcttccagctgcggctgcaggagttcgtcaac
cagcgcggtatgctggccaatgggcagtcctgcgaaccgggctgccggactttcttccgc
atctgccttaagcacttccaggcaaccttctccgagggaccctgcacctttggcaatgtc
tccacgccggtattgggcaccaactccttcgtcgtcagggacaagaatagcggcagtggt
cgcaaccctctgcagttgcccttcaatttcacctggccgggaaccttctcactcaacatc
caagcttggcacacaccgggagacgacctgcggccagagacttcgccaggaaactctctc
atcagccaaatcatcatccaaggctctcttgctgtgggtaagatttggcgaacagacgag
caaaatgacaccctcaccagactgagctactcttaccgggtcatctgcagtgacaactac
tatggagagagctgttctcgcctatgcaagaagcgcgatgaccacttcggacattatgag
tgccagccagatggcagcctgtcctgcctgccgggctggactgggaagtactgtgaccag
cctatatgtctttctggctgtcatgagcagaatggttactgcagcaagccagatgagtgc
atctgccgtccaggttggcagggtcgcctgtgcaatgaatgtatcccccacaatggctgt
cgtcatggcacctgcagcatcccctggcagtgtgcctgcgatgagggatggggaggtctg
ttttgtgaccaagatctcaactactgtactcaccactctccgtgcaagaatggatcaacg
tgttccaacagtgggccaaagggttatacctgcacctgtctcccaggctacactggtgag
cactgtgagctgggactcagcaagtgtgccagcaacccctgtcgaaatggtggcagctgt
aaggaccaggagaatagctaccactgcctgtgtcccccaggctactatggccagcactgt
gagcatagtaccttgacctgcgcggactcaccctgcttcaatgggggctcttgccgggag
cgcaaccaggggtccagttatgcctgcgaatgcccccccaactttaccggctctaactgt
gagaagaaagtagacaggtgtaccagcaacccgtgtgccaatggaggccagtgccagaac
agaggtccaagccgaacctgccgctgccggcctggattcacaggcacccactgtgaactg
cacatcagcgattgtgcccgaagtccctgtgcccacgggggcacttgccacgatctggag
aatgggcctgtgtgcacctgccccgctggcttctctggaaggcgctgcgaggtgcggata
acccacgatgcctgtgcctccggaccctgcttcaatggggccacctgctacactggcctc
tccccaaacaacttcgtctgcaactgtccttatggctttgtgggcagccgctgcgagttt
cccgtgggcttgccacccagcttcccctgggtagctgtctcgctgggcgtggggctagtg
gtactgctggtgctcctggtcatggtggtagtggctgtgcggcagctgcggcttcggagg
cccgatgacgagagcagggaagccatgaacaatctgtcagacttccagaaggacaaccta
atccctgccgcccagctcaaaaacacaaaccagaagaaggagctggaagtggactgtggt
ctggacaagtccaattgtggcaaactgcagaaccacacattggactacaatctagccccg
ggactcctaggacggggcggcatgcctgggaagtatcctcacagtgacaagagcttagga
gagaaggtgccacttcggttacacagtgagaagccagagtgtcgaatatcagccatttgc
tctcccagggactctatgtaccaatcagtgtgtttgatatcagaagagaggaacgagtgt
gtgattgccacagaggtataa

DBGET integrated database retrieval system