KEGG   Mus musculus (mouse): 13395Help
Entry
13395             CDS       T01002                                 

Gene name
Dlx5, AI385752
Definition
(RefSeq) distal-less homeobox 5
  KO
K18489  homeobox protein DLX5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    13395 (Dlx5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13395 (Dlx5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Dll
    13395 (Dlx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DLL_N Homeodomain Homeobox_KN YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 13395
NCBI-ProteinID: NP_034186
MGI: 101926
Ensembl: ENSMUSG00000029755
Vega: OTTMUSG00000021177
UniProt: P70396 Q3TYA7
LinkDB All DBs
Position
6 A1; 6 2.83 cM
AA seq 289 aa AA seqDB search
MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCS
PTSASYGKALNPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEK
EVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQ
VKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAH
PPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagtgtttgacagaagagtcccaagcatccgatccggcgacttccaagctccg
ttcccgacgtccgccgccatgcaccacccgtctcaggaatcgccaactttgcccgagtcc
tcggccaccgattctgactactacagtcccgcgggggccgccccgcacggctactgctct
cctacctctgcttcttatggcaaagcgctcaacccctaccagtaccagtaccacggcgtg
aacggctccgcagccggctacccggccaaggcttatgccgactacggctacgccagcccc
taccaccagtacggcggcgcctacaaccgcgtcccgagtgccaccagccagccagagaaa
gaagtggcggagccagaggtgaggatggtgaatggtaaaccaaagaaagttcgtaaaccc
aggactatttattccagctttcagctggccgctttacagagaaggtttcagaagactcag
tacctcgccctgccagaacgcgcggagttggccgcctctctaggactgacgcaaacacag
gtgaaaatctggtttcagaacaaaagatccaagatcaagaagatcatgaaaaacggggag
atgcccccggagcacagtcccagctccagcgaccctatggcgtgtaactcgccacagtca
ccagcggtgtgggagccccagggctcatcccgctctctcagccaccaccctcatgcccac
cctccgacctccaaccagtcccccgcgtccagctacctggagaactcggcttcctggtac
ccaagcgcagccagctcaatcaattcccacctgccaccgccgggctccttgcagcacccg
ctggcactggcctccgggacgctttattag

DBGET integrated database retrieval system