KEGG   Mus musculus (mouse): 13607Help
Entry
13607             CDS       T01002                                 

Gene name
Eda, EDA1, Ed1, Eda-A1, Eda-A2, HED, Ta, Tnlg7c, XLHED, tabby
Definition
(RefSeq) ectodysplasin-A
  KO
K05480  ectodysplasin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    13607 (Eda)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13607 (Eda)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13607 (Eda)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   13607 (Eda)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Collagen
Motif
Other DBs
NCBI-GeneID: 13607
NCBI-ProteinID: NP_034229
MGI: 1195272
Ensembl: ENSMUSG00000059327
Vega: OTTMUSG00000018058
UniProt: O54693 Q3UV69
LinkDB All DBs
Position
X C3; X 43.59 cM
AA seq 391 aa AA seqDB search
MGYPEVERREPLPAAAPRERGSQGCGCRGAPARAGEGNSCRLFLGFFGLSLALHLLTLCC
YLELRSELRRERGTESRLGGPGAPGTSGTLSSPGSLDPVGPITRHLGQPSFQQQPLEPGE
DPLPPDSQDRHQMALLNFFFPDEKAYSEEESRRVRRNKRSKSGEGADGPVKNKKKGKKAG
PPGPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADK
TGTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGT
YFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKI
AVKMVHADISINMSKHTTFFGAIRLGEAPAS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgggctacccagaggtagagcgcagggaacccctgcctgcggcagcgccaagggagcgg
ggcagccagggctgcggctgtcgcggggcccctgctcgggcgggcgaagggaacagctgc
cggctcttcctgggtttctttggcctctcgctggccctccacctgctgacgctgtgctgc
tacctagagttgcggtccgaattgcggcgggaacggggaaccgagtcccgcctcggtggc
ccgggtgctcctggcacctctggcaccctaagcagccctgggagcctcgacccggtgggt
cccatcacccgccacctggggcagccgtcctttcaacagcagcctttggaaccgggagaa
gatccactcccccctgactcccaggaccggcaccagatggccctcctgaatttcttcttt
cctgatgaaaaggcatattctgaagaggaaagtaggcgtgttcgccgcaataagagaagc
aaaagtggtgaaggagcagatggtcctgttaaaaacaagaaaaagggaaagaaggcaggg
ccacctgggcccaacggccccccaggacctccaggacctccgggaccccagggacctcca
gggattccaggaattcctgggattccaggaacaactgttatgggaccacctggcccacct
ggccctcctggtcctcaaggaccccctggcctccaaggaccttctggtgctgctgataaa
actggaactcgggaaaatcagccagctgtggtgcatctgcagggccaagggtcagcaatt
caagtcaaaaatgatctttcaggtggagtgctcaatgactggtctcgcatcactatgaac
cctaaggtgtttaaactacatccccgcagcggggagctggaggtactggtggacggcacc
tacttcatctatagtcaggtagaagtctactacatcaacttcactgactttgccagctac
gaggtggtggtggatgagaagcccttcctgcagtgcacccgcagcattgagacagggaag
accaactacaacacttgctatactgcaggcgtgtgcctcctcaaggccaggcagaaaatc
gccgtgaagatggtgcacgctgacatctctatcaatatgagcaagcacaccaccttcttc
ggggccatcaggctgggcgaagcccctgcatcctag

DBGET integrated database retrieval system