KEGG   Mus musculus (mouse): 13614Help
Entry
13614             CDS       T01002                                 

Gene name
Edn1, ET-1, PPET1, preproET
Definition
(RefSeq) endothelin 1
  KO
K16366  endothelin-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04270  Vascular smooth muscle contraction
mmu04668  TNF signaling pathway
mmu04916  Melanogenesis
mmu04924  Renin secretion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    13614 (Edn1)
   04066 HIF-1 signaling pathway
    13614 (Edn1)
   04024 cAMP signaling pathway
    13614 (Edn1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13614 (Edn1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    13614 (Edn1)
   04916 Melanogenesis
    13614 (Edn1)
   04924 Renin secretion
    13614 (Edn1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    13614 (Edn1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13614 (Edn1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    13614 (Edn1)
   05410 Hypertrophic cardiomyopathy (HCM)
    13614 (Edn1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    13614 (Edn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endothelin
Motif
Other DBs
NCBI-GeneID: 13614
NCBI-ProteinID: NP_034234
MGI: 95283
Ensembl: ENSMUSG00000021367
UniProt: P22387 Q544E0
LinkDB All DBs
Position
13 A4; 13 20.82 cM
AA seq 202 aa AA seqDB search
MDYFPVIFSLLFVTFQGAPETAVLGAELSTGAENGVQSPPPSTPWRPRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPERVVPYGLGGSSRSKRSLKDLLPNKATDQAVRCQCAHQKDKKC
WNFCQAGKELRAQSTMQKSLKDSKKGKPCSKLGKKCIYQQLVEGRKLRRLEAISNSIKAS
FRVAKLKAELYRDQKLTHNRAH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggattattttcccgtgatcttctctctgctgttcgtgactttccaaggagctccagaa
acagctgtcttgggagccgaactcagcaccggagctgagaatggagtgcagagcccccct
cccagcacaccctggagaccccgcaggtccaagcgctgttcctgttcttccttgatggac
aaggagtgtgtctacttctgccacctggacatcatctgggtcaacactcccgagcgcgtc
gtaccgtatggactgggaggttcttccaggtccaagcgttccttgaaagacttacttccc
aataaggccacagaccaggcagttagatgtcagtgcgctcaccaaaaagacaagaagtgc
tggaatttctgccaagcaggaaaagaactcagggcccaaagtaccatgcagaaaagctta
aaagactccaagaaaggaaaaccctgttccaagttgggaaagaagtgtatctatcagcag
ctggtggaaggaaggaaactacgaaggttggaggccatcagcaatagcatcaaggcatct
tttcgtgttgcaaagttgaaagctgagctctatagagaccagaagttgacgcacaaccga
gcacattga

DBGET integrated database retrieval system