KEGG   Mus musculus (mouse): 13618
Entry
13618             CDS       T01002                                 

Gene name
Ednrb, ET-B, ET-BR, ETR-, ETR-b, ETb, Sox10, Sox10m1
Definition
(RefSeq) endothelin receptor type B
  KO
K04198  endothelin receptor type B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04916  Melanogenesis
mmu04926  Relaxin signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    13618 (Ednrb)
   04022 cGMP-PKG signaling pathway
    13618 (Ednrb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    13618 (Ednrb)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    13618 (Ednrb)
   04916 Melanogenesis
    13618 (Ednrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13618 (Ednrb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    13618 (Ednrb)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Endothelin
    13618 (Ednrb)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4 DUF2070
Other DBs
NCBI-GeneID: 13618
NCBI-ProteinID: NP_001129533
MGI: 102720
Ensembl: ENSMUSG00000022122
UniProt: P48302
LinkDB
Position
14 E2.3; 14 53.05 cM
AA seq 442 aa
MQSPASRCGRALVALLLACGFLGVWGEKRGFPPAQATLSLLGTKEVMTPPTKTSWTRGSN
SSLMRSSAPAEVTKGGRGAGVPPRSFPPPCQRNIEISKTFKYINTIVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINTYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DMITSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWLFSFYFCLPLAITAVFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYDQSNPHRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQTFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcaatcgcccgcaagccggtgcggacgcgccttggtggcgctgctgctggcctgtggc
ttcttgggggtatggggagagaaaagaggattcccacctgcccaagccacgctgtcactt
ctcgggactaaagaggtaatgacgccacccactaagacctcctggaccagaggttccaac
tccagtctgatgcgttcctccgcacctgcggaggtgaccaaaggagggaggggggctgga
gtcccgccaagatccttccctcctccgtgccaacgaaatattgagatcagcaagactttt
aaatacatcaacacgattgtgtcgtgcctcgtgttcgtgctaggcatcatcgggaactcc
acgctgctaagaatcatctacaagaacaagtgcatgcgcaatggtcccaatatcttgatc
gccagtctggctctgggagacctactgcacatcatcatagacatacccattaacacctac
aagttgctcgcagaggactggccatttggagctgagatgtgtaagctggtgcccttcata
cagaaggcttctgtgggaatcacagtgctgagtctttgtgctctaagtattgacagatat
cgagctgttgcttcttggagtcgaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttaatttgggtggtctctgtggttctggctgtccccgaagccataggtttt
gatatgattacgtcggactacaaaggaaagcccctaagggtctgcatgcttaatcccttt
cagaaaacagccttcatgcagttttacaagacagccaaagattggtggctgttcagtttc
tacttctgcttgccgctagccatcactgcagtcttttataccctgatgacctgcgaaatg
ctcaggaagaagagcggtatgcagattgctttgaatgatcacttaaagcagagacgagaa
gtggccaagacagtcttctgcctggtcctcgtgtttgctctctgttggcttccccttcac
ctcagccggatcctgaagctcaccctgtatgaccagagcaatccacacaggtgtgagctt
ctgagctttttgttggttttggactacattggtatcaacatggcttctttgaactcctgc
atcaatccaatcgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgt
ttgtgctgctggtgccaaacgtttgaggaaaagcagtccttggaggagaagcagtcctgc
ctgaagttcaaagccaacgatcacggatatgacaacttccggtccagcaataaatacagc
tcgtcttga

DBGET integrated database retrieval system