KEGG   Mus musculus (mouse): 13653
Entry
13653             CDS       T01002                                 

Gene name
Egr1, A530045N19Rik, ETR10, ETR103, Egr-, Egr-1, Krox, Krox-, Krox-1, Krox-24, Krox24, NG, NGF, NGF1, NGF1-A, NGFI-A, NGFIA, TI, TIS8, Zen, Zenk, Zfp-, Zfp-6, Zif26, Zif268, egr
Definition
(RefSeq) early growth response 1
  KO
K09203  early growth response protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04371  Apelin signaling pathway
mmu04912  GnRH signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05020  Prion disease
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    13653 (Egr1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    13653 (Egr1)
   04928 Parathyroid hormone synthesis, secretion and action
    13653 (Egr1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    13653 (Egr1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    13653 (Egr1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    13653 (Egr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13653 (Egr1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    13653 (Egr1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-C2H2_8 zf-H2C2_5
Other DBs
NCBI-GeneID: 13653
NCBI-ProteinID: NP_031939
MGI: 95295
Ensembl: ENSMUSG00000038418
Vega: OTTMUSG00000021064
UniProt: P08046 Q544D6 Q8CAT6
LinkDB
Structure
PDB: 

Position
18 B1; 18 18.76 cM
AA seq 533 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGG
NSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPS
QTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSS
SASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPA
TKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQ
DLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK
DKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGF
PSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcagcggccaaggccgagatgcaattgatgtctccgctgcagatctctgacccgttc
ggctcctttcctcactcacccaccatggacaactaccccaaactggaggagatgatgctg
ctgagcaacggggctccccagttcctcggtgctgccggaaccccagagggcagcggcggt
aatagcagcagcagcaccagcagcgggggcggtggtgggggcggcagcaacagcggcagc
agcgccttcaatcctcaaggggagccgagcgaacaaccctatgagcacctgaccacagag
tccttttctgacatcgctctgaataatgagaaggcgatggtggagacgagttatcccagc
caaacgactcggttgcctcccatcacctatactggccgcttctccctggagcccgcaccc
aacagtggcaacactttgtggcctgaaccccttttcagcctagtcagtggcctcgtgagc
atgaccaatcctccgacctcttcatcctcggcgccttctccagctgcttcatcgtcttcc
tctgcctcccagagcccgcccctgagctgtgccgtgccgtccaacgacagcagtcccatc
tactcggctgcgcccacctttcctactcccaacactgacatttttcctgagccccaaagc
caggcctttcctggctcggcaggcacagccttgcagtacccgcctcctgcctaccctgcc
accaaaggtggtttccaggttcccatgatccctgactatctgtttccacaacaacaggga
gacctgagcctgggcaccccagaccagaagcccttccagggtctggagaaccgtacccag
cagccttcgctcactccactatccactattaaagccttcgccactcagtcgggctcccag
gacttaaaggctcttaataccacctaccaatcccagctcatcaaacccagccgcatgcgc
aagtaccccaaccggcccagcaagacacccccccatgaacgcccatatgcttgccctgtc
gagtcctgcgatcgccgcttttctcgctcggatgagcttacccgccatatccgcatccac
acaggccagaagcccttccagtgtcgaatctgcatgcgtaacttcagtcgtagtgaccac
cttaccacccacatccgcacccacacaggcgagaagccttttgcctgtgacatttgtggg
aggaagtttgccaggagtgatgaacgcaagaggcataccaaaatccatttaagacagaag
gacaagaaagcagacaaaagtgtggtggcctccccggctgcctcttcactctcttcttac
ccatccccagtggctacctcctacccatcccctgccaccacctcattcccatcccctgtg
cccacttcctactcctctcctggctcctccacctacccatctcctgcgcacagtggcttc
ccgtcgccgtcagtggccaccacctttgcctccgttccacctgctttccccacccaggtc
agcagcttcccgtctgcgggcgtcagcagctccttcagcacctcaactggtctttcagac
atgacagcgaccttttctcccaggacaattgaaatttgctaa

DBGET integrated database retrieval system