KEGG   Mus musculus (mouse): 13685Help
Entry
13685             CDS       T01002                                 

Gene name
Eif4ebp1, 4e-bp1, AA959816, PHAS-I
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu03013  RNA transport
mmu04012  ErbB signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04218  Cellular senescence
mmu04910  Insulin signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05221  Acute myeloid leukemia
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    13685 (Eif4ebp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    13685 (Eif4ebp1)
   04066 HIF-1 signaling pathway
    13685 (Eif4ebp1)
   04151 PI3K-Akt signaling pathway
    13685 (Eif4ebp1)
   04152 AMPK signaling pathway
    13685 (Eif4ebp1)
   04150 mTOR signaling pathway
    13685 (Eif4ebp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    13685 (Eif4ebp1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    13685 (Eif4ebp1)
  09149 Aging
   04211 Longevity regulating pathway
    13685 (Eif4ebp1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    13685 (Eif4ebp1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    13685 (Eif4ebp1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    13685 (Eif4ebp1)
   05163 Human cytomegalovirus infection
    13685 (Eif4ebp1)
   05165 Human papillomavirus infection
    13685 (Eif4ebp1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13685 (Eif4ebp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13685 (Eif4ebp1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     13685 (Eif4ebp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF_4EBP
Motif
Other DBs
NCBI-GeneID: 13685
NCBI-ProteinID: NP_031944
MGI: 103267
Ensembl: ENSMUSG00000031490
Vega: OTTMUSG00000061031
UniProt: Q60876
LinkDB All DBs
Position
8 A2; 8 15.95 cM
AA seq 117 aa AA seqDB search
MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLME
CRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgggcagcagctgcagccagactcccagccgggccatccccactcgccgcgta
gccctcggcgatggcgtgcagctcccgcccggggactacagcaccactccgggcggcacg
ctcttcagcaccaccccgggaggaaccaggattatctatgaccggaaatttctgatggag
tgtcggaactcacctgtggccaaaacacccccaaaggacctgccagccattcctggggtc
actagccctaccagcgatgagcctcccatgcaagccagccagagccaactgcccagcagc
ccggaagataagcgggcaggcggtgaagagtcacaatttgagatggacatttaa

DBGET integrated database retrieval system