KEGG   Mus musculus (mouse): 13712Help
Entry
13712             CDS       T01002                                 

Gene name
Elk1, Elk-1
Definition
(RefSeq) ELK1, member of ETS oncogene family
  KO
K04375  ETS domain-containing protein Elk-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04510  Focal adhesion
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu05020  Prion diseases
mmu05140  Leishmaniasis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05213  Endometrial cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    13712 (Elk1)
   04010 MAPK signaling pathway
    13712 (Elk1)
   04012 ErbB signaling pathway
    13712 (Elk1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13712 (Elk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    13712 (Elk1)
   04912 GnRH signaling pathway
    13712 (Elk1)
   04921 Oxytocin signaling pathway
    13712 (Elk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13712 (Elk1)
   05205 Proteoglycans in cancer
    13712 (Elk1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    13712 (Elk1)
   05213 Endometrial cancer
    13712 (Elk1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    13712 (Elk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    13712 (Elk1)
   05161 Hepatitis B
    13712 (Elk1)
   05163 Human cytomegalovirus infection
    13712 (Elk1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    13712 (Elk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13712 (Elk1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    13712 (Elk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 13712
NCBI-ProteinID: NP_031948
MGI: 101833
Ensembl: ENSMUSG00000009406
Vega: OTTMUSG00000017185
UniProt: P41969
LinkDB All DBs
Position
X A1.3; X 16.45 cM
AA seq 429 aa AA seqDB search
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHA
GPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPIPPRPAS
VLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLDPS
FGHPQPPEVKVEGPKEELEAARAGGFSSEAVKAEPEVSASEGLLARLPAILTENTAQVCG
LSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAPGPALTPSLLPT
HTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPV
VLSPGPQKP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagcttctgagagaacaaggtaat
ggccacatcatctcctggacctcacgggatggtggtgagttcaagttggtggatgcagag
gaggtggcccggctatggggactgcgcaagaacaagaccaacatgaattacgacaagctt
agccgggccttgcggtactactatgataagaatatcatccgcaaggtgagcggccagaag
tttgtctacaagtttgtgtcctacccagaggttgcagggtgctccactgaagactgccca
ccccagcctgaggtgtctgtaacctcggccatagccatggcccctgctactgtccatgca
ggcccaggggacactgccactggaaagccaggaacaccaaagggtgcaggaatgacaggc
caaggtggcttagcacgaagcagccggaatgaatacatgcgctcgggcctctattctacc
ttcacaatacaatccctgcagccacagccacagccacccattcctcctcggcctgcctca
gtgcttcccaacactacccctgcaggagtaccagcacccgcctcagggagcaggagcacc
agtccaaaccccttagaagcctgtttggaagcagaagaggctggtctgcccctgcaggtt
atcctaaccccaccagaggccccaaaccagaaatccgaagagttgagtctggacccaagt
tttggccatccacagcccccagaagtcaaagtggaggggcctaaggaagaattggaagct
gcaagggctggaggcttcagttcagaagctgtcaaagctgaaccagaagtctcagcctca
gaaggcctgctggctcggctcccagccatcctaacagagaacacagcccaggtgtgtggc
ctctccacttccaccactgagatcacccaaccgcagaagggccgaaagcctcgggacctg
gaacttccacttagcccaagcctgctgggtggccagggacctgaacggactccaggatca
ggaacaagctctggtcttcaggcaccggggccagcgctaacgccatccctgctccccaca
cataccttgaccccggtgctgctgacacccagctcgctgccccctagcatccatttctgg
agcactctgagtccaattgcaccccgtagtccagccaagctctccttccagtttccgtcc
agtggcagcgcacaggtgcacatcccttccatcagtgtggatggcctctcgacccccgtg
gtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system