KEGG   Mus musculus (mouse): 13990Help
Entry
13990             CDS       T01002                                 

Gene name
Smarcad1, AV081750, AW226546, D6Pas1, Etl1, etl-1, mKIAA1122
Definition
(RefSeq) SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1
  KO
K14439  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    13990 (Smarcad1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    13990 (Smarcad1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     13990 (Smarcad1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    13990 (Smarcad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII ERCC3_RAD25_C DEAD CUE Pox_D5
Motif
Other DBs
NCBI-GeneID: 13990
NCBI-ProteinID: NP_031984
MGI: 95453
Ensembl: ENSMUSG00000029920
Vega: OTTMUSG00000057081
UniProt: Q04692
LinkDB All DBs
Position
6 C1; 6 30.11 cM
AA seq 1021 aa AA seqDB search
MNLFNLDRFRFEKRSKIEEAPEAAPQPSQARPSSPISLSAEEENAEGEGSRANTPDSDVT
EKTEDSSVPEPPDNERKASLSCFQNQRAIQEYIDLSSDTEDVSPNCSSTVQEKKFSKDTV
IIVSEPSEDEESHDLPSVTRRNDSSELEDLSELEDLKDAKLQTLKELFPQRSDSDLLKLI
ESTSTMDGAIAAALLMFGDAGGGPRKRKLSSSSEEDDVNDDQSVKQPRGDRGEESNESAE
ASSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDVQCASQS
EVTNGKEVARNQNYSKNATKIKMKQKISVKPQNGFNKKRKKNVFNPKKAVEDSEYDSGSD
AGSSLDEDYSSCEEVMEDGYKGKILHFLQVSSIAELTLIPKCSQKKAQKITELRPFNNWE
ALFTKMSKINGLSEDLIWNCKTVIQERDVVIRLMNKCEDISNKLTKQVTMLTGNGGGWNR
EQPSLLNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLFQEGNK
GPHLIVVPASTIDNWLREVNLWCPSLNVLCYYGSQEERKQIRFNIHNKYEDYNVIVTTYN
CAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINARNRLLLTGTPVQNNLL
ELMSLLNFVMPHMFSSSTSEIRRMFSSKTKPADEQSIYEKERIAHAKQIIKPFILRRVKE
EVLKLLPPKKDRIELCAMSEKQEQLYSGLFNRLKKSINNLEKNTEMCNVMMQLRKMANHP
LLHRQYYTPEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYQHINSYQL
DMDLILDSGKFRALGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQ
ISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHR
VGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEADEGSMPADIATLLKTSMG
L
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttttcaacttggaccgttttcgctttgagaaaaggagtaagattgaggaagca
cccgaagcagcccctcagccctcccaggcccgtccttcgtcaccaatttctcttagtgct
gaagaggagaatgctgaaggggaaggtagcagggcaaacaccccagactcagatgtaact
gagaaaacagaagattctagtgttccagaaccgccagacaatgaaagaaaagcaagttta
tcatgtttccaaaatcaaagagcaatacaggaatatattgatttatcatctgatactgaa
gatgtttctccaaattgttccagtacagttcaagagaaaaaattcagcaaagacacagtg
attatagtttcagagccatctgaagatgaagaatcccatgaccttccttctgttacacga
agaaatgacagttcagaactggaagacctttcagaattggaagatcttaaagatgctaag
cttcagacattgaaggaactgtttccacaaagaagtgacagtgatcttctaaagttgatt
gaatcaacaagcactatggatggagccattgctgctgccttgctgatgtttggtgatgca
ggtggtggacccaggaaaaggaaattatcttcttcttctgaggaggatgacgttaatgat
gatcagtctgtaaaacagccgcgaggggaccgtggagaagaatcaaatgagtctgcagaa
gccagcagcaactgggaaaagcaagaaagtattgtgttgaaattgcaaaaggaatttcca
aattttgataaacaggaattaagagaagtgcttaaggagcatgagtggatgtacacagaa
gccttggagtctctgaaagtgtttgcggaagatcaagacgtgcagtgtgcttcacaaagt
gaagttacaaatggaaaagaagttgcaaggaatcaaaattattctaaaaatgcaactaaa
ataaaaatgaaacagaaaatttccgtgaaaccacaaaatggctttaacaagaaacgtaag
aaaaatgtatttaatcctaagaaagccgtagaggactctgagtacgattcaggttctgat
gctgggagctcactggatgaggactatagcagttgtgaagaagtgatggaggacggctat
aaaggcaaaattcttcatttccttcaagtttcttcaattgctgaactgactttgattcct
aagtgttctcagaaaaaggctcagaaaataacagaactccggccctttaataattgggaa
gctctgtttacaaagatgtctaaaatcaatggcctatctgaagatttgatatggaattgc
aaaacggtaattcaagaaagggacgtagttataagacttatgaacaaatgtgaggacatt
tcaaataaactgaccaaacaagttacgatgctcaccgggaatggaggcggatggaacaga
gaacagccctcccttctaaaccaaagtttgtcactcaagccctatcagaaggttgggttg
aactggctggcgttggtgcataagcatggacttaatggcattctggcagacgaaatgggc
ctaggaaaaaccattcaagccattgcattcctggcatacctctttcaagagggtaataaa
gggcctcatttgattgttgttccagcctccaccatagataactggttaagagaagttaac
ttatggtgccccagtttaaatgtgctctgttactatggttctcaagaagagcgtaagcaa
attagattcaacatccataataagtatgaggattacaatgtaattgttacaacgtataat
tgtgcaatcagcagctctgatgaccgcagtctctttcgacgactgaaactgaattatgca
atttttgatgaaggccatatgctgaagaatatgggctctatccgctatcaacatctaatg
acaattaatgcacgtaaccgtttattgctcacaggcacacctgtgcagaataatctgcta
gaactcatgtcattgttgaattttgttatgccacacatgtttagcagtagcaccagtgaa
atccgaaggatgttttcttctaaaacgaaaccagcagacgagcagagtatatacgaaaag
gagagaatagcccacgcgaagcaaatcattaagcccttcatcctcaggagagtgaaggag
gaggttcttaagctcctgcctcccaagaaggatcggattgagctatgtgcgatgtcagag
aagcaggagcagctctactcgggcctcttcaacagattgaaaaagtctatcaacaacctg
gaaaaaaacacagagatgtgcaatgtcatgatgcaattgagaaaaatggccaatcaccct
ttactacaccgccagtattacacacctgagaaactgaaggagatgtctcagctaatgctg
aaggaacctacgcactgtgaggccaaccctgacctgatctttgaagacatggaagttatg
acagattttgaactacatgtactttgtaaacagtatcaacacattaatagttaccagtta
gacatggatttaattttagattctgggaaattccgagccttaggatgcatcttgtctgag
ttgaaacagaagggtgatagagttgtattattcagccagtttaccatgatgctggatata
ctagaggttctcttaaagcatcatcaacataggtacctccgattagatggaaagactcag
atttctgaaaggattcatctaattgatgagtttaatacagatatggatatctttgtattt
ctcttgtcaactaaagctggtggactaggaataaatcttacttcagcaaatgttgttata
cttcacgacattgattgcaatccatacaatgacaaacaagcagaagacaggtgccataga
gttggtcagactaaagaagtattagttattaaattaataagccaaggaactattgaagag
tccatgctaaaaattaaccaacaaaagttgaaactagagcaagacatgaccacagtagat
gaagctgatgaaggaagtatgccagcagatatagccacattactaaaaacatcaatgggc
ctgtga

DBGET integrated database retrieval system