KEGG   Mus musculus (mouse): 14013Help
Entry
14013             CDS       T01002                                 

Gene name
Mecom, D630039M04Rik, Evi-1, Evi1, Jbo, Mds, Mds1, Mds1-Evi1, Prdm3, Znfpr1b1
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu05200  Pathways in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14013 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14013 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    14013 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14013 (Mecom)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    14013 (Mecom)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 14013
NCBI-ProteinID: NP_067417
MGI: 95457
Ensembl: ENSMUSG00000027684
Vega: OTTMUSG00000038143
UniProt: P14404
LinkDB All DBs
Position
3 A3; 3 12.66 cM
AA seq 129 aa AA seqDB search
MRSKGRARKLATSNECAYGNYPEIPLEEMPDADADGITSVPSLHIQEPCSPATSSESFTP
KEGSPYKAPIYIPDDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLK
DSSYGWENR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgcctatggcaac
tatcctgaaatacctttggaagaaatgccagatgctgatgcagatgggataaccagtgtt
ccctccctccacattcaagagccatgctctcctgcgacgtccagtgagtcatttactcct
aaggagggctcgccatacaaagctcccatctacatccctgatgacatccctattcctgat
gagtttgagcttcgagagtcaactatgcctggagcaggacttggaatatggaccaaaagg
aagattgaaataggcgaaaagtttgggccatacatgggagagcagagatcagacctgaaa
gattccagctatggatgggagaacaggtga

DBGET integrated database retrieval system