KEGG   Mus musculus (mouse): 14061Help
Entry
14061             CDS       T01002                                 

Gene name
F2, Cf-2, Cf2, FII
Definition
(RefSeq) coagulation factor II
  KO
K01313  coagulation factor II (thrombin) [EC:3.4.21.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    14061 (F2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14061 (F2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14061 (F2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14061 (F2)
   04611 Platelet activation
    14061 (F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14061 (F2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14061 (F2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14061 (F2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14061 (F2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.5  thrombin
     14061 (F2)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   14061 (F2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   14061 (F2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   14061 (F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle Thrombin_light Gla DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 14061
NCBI-ProteinID: NP_034298
MGI: 88380
Ensembl: ENSMUSG00000027249
Vega: OTTMUSG00000014282
UniProt: P19221 Q3TJ94
LinkDB All DBs
Structure
PDB: 

Position
2 E1; 2 50.63 cM
AA seq 618 aa AA seqDB search
MSHVRGLGLPGCLALAALVSLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGVNYLGT
VNVTHTGIQCQLWRSRYPHKPEINSTTHPGADLKENFCRNPDSSTTGPWCYTTDPTVRRE
ECSVPVCGQEGRTTVVMTPRSGGSKDNLSPPLGQCLTERGRLYQGNLAVTTLGSPCLPWN
SLPAKTLSKYQDFDPEVKLVENFCRNPDWDEEGAWCYVAGQPGDFEYCNLNYCEEAVGEE
NYDVDESIAGRTTDAEFHTFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGR
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLL
VRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCL
PDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR
ITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFY
THVFRLKRWIQKVIDQFG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgtccgcggcctgggcctccctggctgcttggctctggctgccctggttagc
ctggtacacagccagcatgtgttcctggcgcctcagcaagcactatcgctgctccagcgg
gtccgcagagccaacagtggcttcctggaggagctccgaaagggcaacctagagcgtgag
tgcgtggaagagcagtgcagctatgaggaggcctttgaggccctggagtctccccaagac
acagacgtgttctgggccaagtacacagtgtgtgattcagtgaggaaacctcgagagact
ttcatggactgtctggaaggtcgctgtgctatggatctgggtgtgaactaccttgggact
gtgaatgtcacccataccggtatccagtgccagctgtggcggagccgctacccccacaag
cctgaaatcaactccaccacccatcctggggcagacctgaaggagaacttctgccgcaat
ccagacagcagtaccacgggaccctggtgctacaccacagatcctactgtgcgcagagag
gaatgcagtgtccctgtctgtggccaggagggccgtaccactgtggtgatgactcctcgc
tctggaggttccaaggacaatctgtcacctccactgggacagtgcctcactgagcgtggc
cgactataccaggggaatttggctgtgacaacacttgggtccccctgcctgccctggaac
agcttaccagccaagaccctgagcaagtaccaagacttcgaccccgaggtgaaactcgtg
gaaaacttctgccgcaacccagactgggatgaggagggcgcatggtgctatgttgcgggg
cagcctggcgactttgaatactgcaacctcaactactgcgaggaggcggtgggagaggag
aactatgatgtggacgagtccatcgcgggacgcaccaccgatgcggagttccacaccttc
ttcaatgagaagaccttcggccttggggaggcagactgtggcctgcggcctttgttcgag
aagaagtcgttgaaagacacaaccgaaaaggagcttcttgactcttacatagacgggcgc
atcgtggagggctgggacgctgagaagggtatcgccccctggcaggtgatgctttttcgg
aagagtccccaagagctgctgtgtggggccagccttatcagtgaccgatgggtcctcact
gctgcccactgcattctgtacccaccctgggacaagaacttcactgagaatgacctcctg
gtgcgcattggcaagcattcccgaaccagatatgagcggaatgttgaaaagatctccatg
ctggaaaagatctacgtccaccccagatataactggcgggagaacctagaccgcgatatc
gctctgctcaagctaaagaaacctgtacccttcagtgactatattcaccccgtgtgtttg
ccagacaagcagacagtaaccagcttgctccgggctggttataaagggcgggtgacaggc
tggggcaaccttcgggagacatggacaaccaacatcaatgagatacagcccagcgtcctg
caggtggtgaacctgcccattgtagagcggccagtgtgcaaggcctccacccggattcga
attactgacaacatgttctgtgctggcttcaaggtgaatgacaccaagcgaggagatgct
tgtgaaggtgacagtggaggaccttttgtcatgaagagcccctttaacaaccgctggtat
caaatgggtattgtctcatggggtgaaggatgtgaccggaaggggaaatacggcttctac
acgcatgtgttccgtctgaaaaggtggatacagaaagtcattgatcaatttggatag

DBGET integrated database retrieval system